The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 119

For teachers and parents. Prints separately from the student sheets.

Psalms 119 · For teachers and parents

Answer Key: A Lamp to My Feet

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolA Lamp for My Feet

scrolllamppersonheartlight

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod's Word

LAMP → picture 4LIGHT → picture 3PATH → picture 1WORD → picture 2

Grade 1Your Word Is a Lamp

I have hidden your word in my heart. → picture 5Open my eyes. → picture 1Your word is a lamp to my feet. → picture 4How I love your law! → picture 2I have gone astray like a lost sheep. → picture 3

Order:

1. I have hidden your word in my heart2. Open my eyes, that I may see wondrous things out of your law3. Your word is a lamp to my feet

Grade 2I Love God's Word

  1. How many verses does Psalm 119 have? 176 (circle)
  2. What is the psalm all about? God's word (circle)
  3. What is God's word like? A lamp to my feet
  4. Where does the singer hide God's word? In his heart (circle)
  5. What is sweeter than honey? God's promises (circle)
WMJVLYJNJOLFNGIAWFRDAGGDGLUDPEMJSKHKDPLLHEARTELAIIOLAWJHMTGGSKDVHPIHYHJNBFCGUVLTI

Grade 3Light for My Path

  1. What is special about Psalm 119? It is the longest chapter in the Bible.
  2. How can a young man keep his way pure? By living according to God's word
  3. Why did the singer hide God's word in his heart? So that he might not sin against God
  4. What is God's word to his path? A light
  5. What does he ask God to do at the end? Seek him
1: I have hidden your word in my heart2: Open my eyes, that I may see wondrous things out of your law3: Your word is a lamp to my feet
UHNMUSKMDKDEFJPLPMWHDWUETAOIEMEOFDPWDALALROARHRAJKIDTLATMCPFGHKVHPFTFHHPMELIGHTHT

Grade 4A Song About God's Word

  1. How is Psalm 119 arranged? In 22 sections of 8 verses, one for each Hebrew letter
  2. Name three words the psalm uses for Scripture. Law, statutes, and precepts
  3. What does the singer ask God to open? His eyes
  4. How does the psalm end? He says he has gone astray like a lost sheep and asks God to seek him.

Word bank: 1. word; 2. heart; 3. law; 4. lamp

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Loving God Through His Word

  1. How is Psalm 119 structured? As an acrostic of 22 sections of 8 verses
  2. Why is the psalm more than a list of rules? It is a prayer of love to the God who speaks.
  3. What does an ancient lamp show about following God? It lit only a few steps, so the traveler trusted God one step at a time.
  4. How does the end of Psalm 119 connect to Jesus? Jesus tells of a shepherd who goes after the lost sheep (Luke 15:4).
4HEART3WOD2PAT1LAMIGHT

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.