The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 119

Every grade prints starting on a new page. No answers are included.

Psalms 119 · Preschool

A Lamp for My Feet

Name Date

Color the lamp and the path. God's word helps us know where to go.

Can you find these in the picture? Circle each one!

Bible Verse

“Your word is a lamp to my feet, and a light for my path.”

Psalms 119:105 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: A lamp helps us see in the dark. God's word helps us know the right way. Let's walk carefully like we are following a light.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 119 · Kindergarten

God's Word

Name Date

Trace the Words

Trace each word with your pencil.

LAMP
LIGHT
PATH
WORD
Your word is a lamp to my feet, and a light for my path.

Psalms 119:105 (WEB)

Match the Pictures

Draw a line from each word to its picture.

LAMP
LIGHT
PATH
WORD

Mini Maze

Help find the way through the maze.

Draw It

Draw a lamp lighting a path.

Prayer

Dear God, thank You for your word that lights my way. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can God's Word help you?
  • The Bible is a gift. Who reads the Bible with you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 119 · Grade 1

Your Word Is a Lamp

Name Date

Trace the Words

Trace the words and the verse.

WORD
HEART
LAMP
HONEY
Your word is a lamp to my feet, and a light for my path.

Psalms 119:105 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

I have hidden your word in my heart.
Open my eyes.
Your word is a lamp to my feet.
How I love your law!
I have gone astray like a lost sheep.

A Lamp to My Feet

Write the number 1 to 3 in each circle to show the right order.

I have hidden your word in my heart

Your word is a lamp to my feet

Open my eyes, that I may see wondrous things out of your law

Draw a lamp lighting a path.

Memory Verse

“Your word is a lamp to my feet, and a light for my path.”

Psalms 119:105 (WEB)

Prayer

Dear God, thank You for your word that lights my way. Help me . Amen.

Take It Home

For families: talk about these together.

  • What is sweeter than honey?
  • How does the Bible help you choose what to do?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 119 · Grade 2

I Love God's Word

Name Date

Read the Story

Psalm 119 is the longest psalm. It has 176 verses! It is all about God's word.

The singer says, your word is a lamp to my feet. It shows him the right way to go. He hides God's word in his heart. He asks God to open his eyes. God's promises taste sweeter than honey to him.

Memory Verse

“Your word is a lamp to my feet, and a light for my path.”

Psalms 119:105 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. How many verses does Psalm 119 have?

    In his heartGod's promises176

  2. What is the psalm all about?

    176God's wordIn his heart

  3. What is God's word like?

  4. Where does the singer hide God's word?

    A lamp to my feetIn his heart176

  5. What is sweeter than honey?

    In his heartGod's wordGod's promises

Word Search

Find and circle each word. Words go across and down.

WMJVLYJNJOLFNGIAWFRDAGGDGLUDPEMJSKHKDPLLHEARTELAIIOLAWJHMTGGSKDVHPIHYHJNBFCGUVLTI
  • DELIGHT
  • LIGHT
  • HEART
  • WORD
  • LAMP
  • PATH
  • LAW

Prayer

Dear God, thank You for your word that lights my way. Help me . Amen.

Take It Home

For families: talk about these together.

  • Scripture lights up our path. How can you learn a Bible verse?
  • How can a young person keep his way pure?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 119 · Grade 3

Light for My Path

Name Date

Read the Story

Psalm 119 has no title. It is the longest chapter in the Bible. Almost every verse talks about God's word.

The singer asks, how can a young man keep his way pure? By living according to your word. He says, I have hidden your word in my heart, that I might not sin against you.

He loves God's law and thinks about it all day. He says, your word is a lamp to my feet, and a light for my path. At the end he says he has gone astray like a lost sheep. He asks God to seek him.

Memory Verse

“Your word is a lamp to my feet, and a light for my path.”

Psalms 119:105 (WEB)

Answer the Questions

  1. What is special about Psalm 119?

  2. How can a young man keep his way pure?

  3. Why did the singer hide God's word in his heart?

  4. What is God's word to his path?

  5. What does he ask God to do at the end?

A Lamp to My Feet

Write what happened in each box.

1
2
3

Word Search

Find each word. Words go across, down, and diagonally.

UHNMUSKMDKDEFJPLPMWHDWUETAOIEMEOFDPWDALALROARHRAJKIDTLATMCPFGHKVHPFTFHHPMELIGHTHT
  • DELIGHT
  • LIGHT
  • HEART
  • WORD
  • LAMP
  • PATH
  • LAW

Prayer

Dear God, thank You for your word that lights my way. Help me . Amen.

Take It Home

For families: talk about these together.

  • The singer asked God to open his eyes to wonderful things. What do you want God to show you in the Bible?
  • How can you make time to read God's Word each day?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 119 · Grade 4

A Song About God's Word

Name Date

Read and Think

Psalm 119 has no title and names no author. It is the longest psalm, with 176 verses in 22 sections of 8 verses. In Hebrew, each section starts with the next letter of the alphabet. Almost every verse uses a word for Scripture, such as law, statutes, precepts, commandments, promises, or word.

The singer wants to keep his way pure. He says, I have hidden your word in my heart, that I might not sin against you. He prays, Open my eyes, that I may see wondrous things out of your law. He finds God's promises sweeter than honey.

He says, Your word is a lamp to my feet, and a light for my path. God's word shows the next step. The psalm ends humbly: I have gone astray like a lost sheep. Seek your servant, for I don't forget your commandments.

Show What You Know

  1. How is Psalm 119 arranged?

  2. Name three words the psalm uses for Scripture.

  3. What does the singer ask God to open?

  4. How does the psalm end?

Word Bank Fill-In

Use the word bank to fill in each blank.

wordlawlampheart
  1. Almost every verse uses a for Scripture, such as law, statutes, precepts, commandments, promises, or word.
  2. He says, I have hidden your word in my , that I might not sin against you.
  3. He prays, Open my eyes, that I may see wondrous things out of your .
  4. He says, Your word is a to my feet, and a light for my path.

Think About It

  1. The singer hid God's word in his heart. Which verse would you like to memorize this week?

  2. God's word is a lamp for the next step. Where do you need God's guidance right now?

Memory Verse

“Your word is a lamp to my feet, and a light for my path.”

Psalms 119:105 (WEB)

Copy It

Prayer

Dear God, thank You for your word that lights my way. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why is Psalm 119 called an acrostic?
  • Which Bible passage do you want to memorize this month?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 119 · Grade 5

Loving God Through His Word

Name Date

Read and Think

Psalm 119 has no title and names no author. It is the longest chapter in the Bible: 176 verses arranged as an acrostic, with 22 sections of 8 verses each, one for every letter of the Hebrew alphabet. Nearly every verse names God's word with terms like law, testimonies, precepts, statutes, commandments, ordinances, promises, and word.

The psalm is more than a list of rules. It is a prayer of love to the God who speaks. The singer says, With my whole heart I have sought you. He hides God's word in his heart to avoid sin, asks God to open his eyes, and says, How I love your law! It is my meditation all day. He says God's word is settled in heaven forever and that the entrance of your words gives light.

Verse 105 sums up how Scripture guides: Your word is a lamp to my feet, and a light for my path. A lamp in ancient times lit only a few steps, so the traveler trusted God one step at a time. The psalm ends not with pride but with need: I have gone astray like a lost sheep. Seek your servant. In the New Testament, Jesus tells of a shepherd who goes after the sheep that was lost (Luke 15:4).

Show What You Know

  1. How is Psalm 119 structured?

  2. Why is the psalm more than a list of rules?

  3. What does an ancient lamp show about following God?

  4. How does the end of Psalm 119 connect to Jesus?

Crossword

4321

Across

  1. Your word is a ____ to my feet.
  2. With my whole ____ I have sought you.

Down

  1. The entrance of your words gives ____.
  2. I run in the ____ of your commandments.
  3. I have hidden your ____ in my heart.

Think About It

  1. The singer loved God's word because he loved God. How can reading the Bible become a way to know God better?

  2. The psalm ends by asking God to seek a lost sheep. How does it help to know God seeks you when you wander?

Memory Verse

“Your word is a lamp to my feet, and a light for my path.”

Psalms 119:105 (WEB)

Copy It

Prayer

Dear God, thank You for your word that lights my way. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does a lamp picture God's guidance?
  • The singer said affliction taught him God's statutes. How can suffering deepen your understanding of Scripture?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.