The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 108

For teachers and parents. Prints separately from the student sheets.

Psalms 108 · For teachers and parents

Answer Key: My Heart Is Steadfast

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolWake Up and Sing

sunheartmountain

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenMorning Song

SING → picture 2HARP → picture 4DAWN → picture 1SKY → picture 3

Grade 1I Will Sing

My heart is steadfast, God. → picture 2I will wake up the dawn. → picture 4I will sing praises among the peoples. → picture 5Your faithfulness reaches to the skies. → picture 1Give us help against the enemy. → picture 3

Order:

1. I will wake up the dawn2. I will sing praises to you among the peoples3. For your loving kindness is great above the heavens

Grade 2A Happy Morning Song

  1. What is David's heart like? Steadfast (circle)
  2. What does David tell to wake up? His harp and lyre (circle)
  3. Where will David thank God? Among the nations (circle)
  4. What is greater than the sky? God's loving kindness (circle)
  5. Who does David ask for help? God (circle)
VTGYDMPRLBAPLMGJLHUWLROOUFEGSDIARSFANIHHAIYLVANMETNSFEFGDAWNTENMWYRDPVLSLLOTKWPEY

Grade 3Waking the Dawn

  1. What does David say about his heart? It is steadfast.
  2. Which instruments does David call to wake up? Harp and lyre
  3. What reaches to the skies? God's faithfulness
  4. What does David say about the help of man? It is vain.
  5. Through whom will they do valiantly? Through God
1: I will wake up the dawn2: I will sing praises to you among the peoples3: For your loving kindness is great above the heavens
VMNINTJHNFASPUFOEPCOLIMVLARGSAINLVVAHLTMAGNEIKEODPNVNSKKARACTSEFTWRYWFLSBPCWTMNCY

Grade 4Praise and Prayer Together

  1. Which two psalms does Psalm 108 combine? Psalm 57 and Psalm 60
  2. What does David want to wake up? The dawn
  3. What reason does David give for praising God? God's loving kindness and faithfulness are great.
  4. What does David admit about human help? The help of man is vain.

Word bank: 1. heart; 2. dawn; 3. sing; 4. heavens; 5. God

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5A Steadfast Heart

  1. Where do the two halves of Psalm 108 come from? Psalm 57:7-11 and Psalm 60:5-12
  2. What does a steadfast heart mean? A heart fixed and settled in God
  3. What does God's speech from his sanctuary show? Every land belongs to God.
  4. How does David end the psalm? With trust that through God they will do valiantly
3HEAVEN4S2PRISESEART1DAWING

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.