The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 108

Every grade prints starting on a new page. No answers are included.

Psalms 108 · Preschool

Wake Up and Sing

Name Date

Color the harp and the sun. David woke up early to sing to God!

Can you find these in the picture? Circle each one!

Bible Verse

“Wake up, harp and lyre! I will wake up the dawn.”

Psalms 108:2 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: David played music to God early in the morning. Let's sing a good morning song to God!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 108 · Kindergarten

Morning Song

Name Date

Trace the Words

Trace each word with your pencil.

SING
HARP
DAWN
SKY
I will give thanks to you, Yahweh, among the nations. I will sing praises to you among the peoples.

Psalms 108:3 (WEB)

Match the Pictures

Draw a line from each word to its picture.

SING
HARP
DAWN
SKY

Mini Maze

Help find the way through the maze.

Draw It

Draw the sun rising while you sing.

Prayer

Dear God, thank You for your great loving kindness. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did David play?
  • When do you like to praise God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 108 · Grade 1

I Will Sing

Name Date

Trace the Words

Trace the words and the verse.

HEART
SING
DAWN
HELP
For your loving kindness is great above the heavens. Your faithfulness reaches to the skies.

Psalms 108:4 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

My heart is steadfast, God.
I will wake up the dawn.
I will sing praises among the peoples.
Your faithfulness reaches to the skies.
Give us help against the enemy.

Steadfast Heart

Write the number 1 to 3 in each circle to show the right order.

For your loving kindness is great above the heavens

I will sing praises to you among the peoples

I will wake up the dawn

Draw the sun rising while you sing.

Memory Verse

“For your loving kindness is great above the heavens. Your faithfulness reaches to the skies.”

Psalms 108:4 (WEB)

Prayer

Dear God, thank You for your great loving kindness. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you thank God for always keeping His promises?
  • Who helps us do well?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 108 · Grade 2

A Happy Morning Song

Name Date

Read the Story

The title of Psalm 108 calls it A Song. A Psalm by David. He says his heart is steadfast. That means his heart is firm and sure. He will sing and make music.

He tells his harp to wake up. He wants to wake up the morning! He will thank God among all the nations. God's love is greater than the sky. David asks God for help. He says that with God's help, they will do well.

Memory Verse

“For your loving kindness is great above the heavens. Your faithfulness reaches to the skies.”

Psalms 108:4 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What is David's heart like?

    God's loving kindnessGodSteadfast

  2. What does David tell to wake up?

    GodSteadfastHis harp and lyre

  3. Where will David thank God?

    God's loving kindnessAmong the nationsHis harp and lyre

  4. What is greater than the sky?

    God's loving kindnessSteadfastAmong the nations

  5. Who does David ask for help?

    His harp and lyreGodGod's loving kindness

Word Search

Find and circle each word. Words go across and down.

VTGYDMPRLBAPLMGJLHUWLROOUFEGSDIARSFANIHHAIYLVANMETNSFEFGDAWNTENMWYRDPVLSLLOTKWPEY
  • VALIANTLY
  • PRAISES
  • HEAVENS
  • HEART
  • GLORY
  • SING
  • DAWN

Prayer

Dear God, thank You for your great loving kindness. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you keep trusting God every day?
  • David wanted the whole world to hear God's praise. Where can you sing about God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 108 · Grade 3

Waking the Dawn

Name Date

Read the Story

Psalm 108 is titled A Song. A Psalm by David. David begins, My heart is steadfast, God. I will sing and I will make music with my soul.

He calls to his instruments: Wake up, harp and lyre! He will wake up the dawn with his praise. He will give thanks to Yahweh among the nations. God's loving kindness is great above the heavens.

Then David prays for help. He asks God to save with his right hand. He says the help of man is vain. But through God, we will do valiantly. David trusts God more than people.

Memory Verse

“For your loving kindness is great above the heavens. Your faithfulness reaches to the skies.”

Psalms 108:4 (WEB)

Answer the Questions

  1. What does David say about his heart?

  2. Which instruments does David call to wake up?

  3. What reaches to the skies?

  4. What does David say about the help of man?

  5. Through whom will they do valiantly?

Steadfast Heart

Write what happened in each box.

1
2
3

Word Search

Find each word. Words go across, down, and diagonally.

VMNINTJHNFASPUFOEPCOLIMVLARGSAINLVVAHLTMAGNEIKEODPNVNSKKARACTSEFTWRYWFLSBPCWTMNCY
  • VALIANTLY
  • PRAISES
  • HEAVENS
  • HEART
  • GLORY
  • SING
  • DAWN

Prayer

Dear God, thank You for your great loving kindness. Help me . Amen.

Take It Home

For families: talk about these together.

  • The singer longed for God's right hand to save. How can you help a neighbor in trouble?
  • Why is God's help better than people's help?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 108 · Grade 4

Praise and Prayer Together

Name Date

Read and Think

Psalm 108 is titled A Song. A Psalm by David. It joins parts of two other psalms: verses 1-5 match the end of Psalm 57, and verses 6-13 match the end of Psalm 60. David begins with a steadfast heart, ready to sing and make music with his soul.

David wants to wake up the dawn with praise. He will give thanks to Yahweh among the nations and sing praises among the peoples. His reason is God's greatness: For your loving kindness is great above the heavens. Your faithfulness reaches to the skies. He prays, Be exalted, God, above the heavens!

The second half turns to a request. God has spoken from his sanctuary and claims many lands as his own, from Gilead to Judah. David asks who will lead him into the fortified city. He admits that the help of man is vain. He ends in trust: Through God, we will do valiantly.

Show What You Know

  1. Which two psalms does Psalm 108 combine?

  2. What does David want to wake up?

  3. What reason does David give for praising God?

  4. What does David admit about human help?

Word Bank Fill-In

Use the word bank to fill in each blank.

singheavensdawnheartGod
  1. David begins with a steadfast , ready to sing and make music with his soul.
  2. David wants to wake up the with praise.
  3. He will give thanks to Yahweh among the nations and praises among the peoples.
  4. He prays, Be exalted, God, above the !
  5. has spoken from his sanctuary and claims many lands as his own, from Gilead to Judah.

Think About It

  1. David's heart was steadfast before the day began. How can you start your day with praise?

  2. David said the help of man is vain. Where do you need to trust God instead of only people?

Memory Verse

“For your loving kindness is great above the heavens. Your faithfulness reaches to the skies.”

Psalms 108:4 (WEB)

Copy It

Prayer

Dear God, thank You for your great loving kindness. Help me . Amen.

Take It Home

For families: talk about these together.

  • Where do you need courage from God this week?
  • Where have you seen God stay loyal to you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 108 · Grade 5

A Steadfast Heart

Name Date

Read and Think

Psalm 108 is titled A Song. A Psalm by David. It is built from two earlier songs: verses 1-5 come from Psalm 57:7-11 and verses 6-13 from Psalm 60:5-12. Scripture sometimes reuses older words in a new setting, showing that God's truth fits new needs. Here praise comes first, and the request comes second.

David's heart is steadfast, fixed and settled in God. He will make music with his soul and call his harp and lyre to wake up the dawn. His praise is public, among the nations and peoples, and its reason is God's character: loving kindness great above the heavens and faithfulness that reaches to the skies. He prays that God's glory would be over all the earth.

Then God speaks from his sanctuary, claiming Shechem, Gilead, Ephraim, Judah, and even Moab, Edom, and Philistia. Every land belongs to him. David feels the weight of the battle and asks, Who will lead me to Edom? He confesses that the help of man is vain. The psalm closes with confident trust: Through God, we will do valiantly.

Show What You Know

  1. Where do the two halves of Psalm 108 come from?

  2. What does a steadfast heart mean?

  3. What does God's speech from his sanctuary show?

  4. How does David end the psalm?

Crossword

3421

Across

  1. For your loving kindness is great above the ____.

Down

  1. I will wake up the ____.
  2. I will sing ____ to you among the peoples.
  3. My ____ is steadfast.
  4. I will ____ praises to you among the peoples.

Think About It

  1. David praised God before he asked for help. How could putting praise first change your prayers?

  2. David said the help of man is vain. What does it look like to rely on God when you face something hard?

Memory Verse

“For your loving kindness is great above the heavens. Your faithfulness reaches to the skies.”

Psalms 108:4 (WEB)

Copy It

Prayer

Dear God, thank You for your great loving kindness. Help me . Amen.

Take It Home

For families: talk about these together.

  • How could you begin your talks with God by thanking Him?
  • What goal of yours could you hand over to God?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.