The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 108

Prints on letter paper in black and white. No answers are printed on the student sheet.

Psalms 108 · Grade 2

A Happy Morning Song

Name Date

Read the Story

The title of Psalm 108 calls it A Song. A Psalm by David. He says his heart is steadfast. That means his heart is firm and sure. He will sing and make music.

He tells his harp to wake up. He wants to wake up the morning! He will thank God among all the nations. God's love is greater than the sky. David asks God for help. He says that with God's help, they will do well.

Memory Verse

“For your loving kindness is great above the heavens. Your faithfulness reaches to the skies.”

Psalms 108:4 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What is David's heart like?

    God's loving kindnessGodSteadfast

  2. What does David tell to wake up?

    GodSteadfastHis harp and lyre

  3. Where will David thank God?

    God's loving kindnessAmong the nationsHis harp and lyre

  4. What is greater than the sky?

    God's loving kindnessSteadfastAmong the nations

  5. Who does David ask for help?

    His harp and lyreGodGod's loving kindness

Word Search

Find and circle each word. Words go across and down.

VTGYDMPRLBAPLMGJLHUWLROOUFEGSDIARSFANIHHAIYLVANMETNSFEFGDAWNTENMWYRDPVLSLLOTKWPEY
  • VALIANTLY
  • PRAISES
  • HEAVENS
  • HEART
  • GLORY
  • SING
  • DAWN

Prayer

Dear God, thank You for your great loving kindness. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you keep trusting God every day?
  • David wanted the whole world to hear God's praise. Where can you sing about God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.