The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 1

For teachers and parents. Prints separately from the student sheets.

Psalms 1 · For teachers and parents

Answer Key: Like a Tree by the Water

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolA Strong Tree

treepersonheartscroll

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenLike a Tree

TREE → picture 3FRUIT → picture 1LAW → picture 4WATER → picture 2

Grade 1Two Ways

The blessed man loves God's law. → picture 4He thinks about it day and night. → picture 3He is like a tree by the water. → picture 1The tree gives fruit in its season. → picture 5The wicked are like chaff in the wind. → picture 2

Order:

1. On his law he meditates day and night2. He will be like a tree planted by the streams of water3. The wicked are not so, but are like the chaff which the wind drives away4. For Yahweh knows the way of the righteous

Grade 2Like a Tree

  1. What does the blessed man delight in? Yahweh's law (circle)
  2. When does he think about God's law? Day and night (circle)
  3. What is he like? A tree planted by streams of water
  4. What are the wicked like? Chaff that the wind blows away
  5. Whose way does Yahweh know? The way of the righteous
GLAWBMFEDVBLALERIUMRLTEUUCNYWUEREITDOOIRSETYIESDCWSERRPMCYKAESECHAFFEYDDYKVIWIDEU

Grade 3Two Ways to Live

  1. Where does the blessed man not sit? In the seat of scoffers
  2. What does he do with Yahweh's law? He meditates on it day and night.
  3. Where is the tree planted? By the streams of water
  4. What is chaff? The dry husks that the wind drives away
  5. What will happen to the way of the wicked? It shall perish.
1: On his law he meditates day and night2: He will be like a tree planted by the streams of water3: The wicked are not so, but are like the chaff which the wind drives away4: For Yahweh knows the way of the righteous
YPBWRFKIGWFPLANVRACIRLETEEEPOCUVSELIWMDKIWSRKLAEGETBECAOYAJDPGDWBNTREEKRPEAJCHAFF

Grade 4The Blessed Way

  1. What three things does the blessed man not do? Walk in the counsel of the wicked, stand on the path of sinners, or sit in the seat of scoffers
  2. What is his delight? Yahweh's law
  3. What picture describes the blessed man? A tree planted by the streams of water
  4. What does Yahweh know? The way of the righteous

Word bank: 1. blessed; 2. tree; 3. wicked; 4. chaff; 5. way

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Rooted in God's Word

  1. How does the psalm describe a slide into sin? From walking, to standing, to sitting with the wicked
  2. What does it mean to meditate on God's law? To think deeply about God's words
  3. Where does the tree get its water? It is planted by the streams of water.
  4. What New Testament picture connects to the fruitful tree? Jesus as the vine; the branch that remains in him bears much fruit (John 15:5)
4FRUIT2WAER1LA3TEE5WICKD

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.