The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 1

Every grade prints starting on a new page. No answers are included.

Psalms 1 · Preschool

A Strong Tree

Name Date

Color the tree, the water, and the fruit. A person who loves God's Word is like a strong tree.

Can you find these in the picture? Circle each one!

Bible Verse

“He will be like a tree planted by the streams of water, that produces its fruit in its season, whose leaf also does not wither. Whatever he does shall prosper.”

Psalms 1:3 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: A tree by the water grows big and strong. When we love God's Word, we grow too. Let's stretch up tall like a tree!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 1 · Kindergarten

Like a Tree

Name Date

Trace the Words

Trace each word with your pencil.

TREE
FRUIT
LEAF
LAW
For Yahweh knows the way of the righteous, but the way of the wicked shall perish.

Psalms 1:6 (WEB)

Match the Pictures

Draw a line from each word to its picture.

TREE
FRUIT
LAW
WATER

Mini Maze

Help find the way through the maze.

Draw It

Draw a tree planted by a stream.

Prayer

Dear God, thank You for Your good law. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you grow close to God?
  • What does the wind blow away?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 1 · Grade 1

Two Ways

Name Date

Trace the Words

Trace the words and the verse.

BLESSED
DELIGHT
STREAMS
WIND
For Yahweh knows the way of the righteous, but the way of the wicked shall perish.

Psalms 1:6 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

The blessed man loves God's law.
He thinks about it day and night.
He is like a tree by the water.
The tree gives fruit in its season.
The wicked are like chaff in the wind.

Two Paths

Write the number 1 to 4 in each circle to show the right order.

For Yahweh knows the way of the righteous

On his law he meditates day and night

He will be like a tree planted by the streams of water

The wicked are not so, but are like the chaff which the wind drives away

Draw a tree planted by a stream.

Memory Verse

“For Yahweh knows the way of the righteous, but the way of the wicked shall perish.”

Psalms 1:6 (WEB)

Prayer

Dear God, thank You for Your good law. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who helps you choose the right way?
  • When is a good time for you to read the Bible?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 1 · Grade 2

Like a Tree

Name Date

Read the Story

Psalm 1 tells about a blessed man. He does not walk in the counsel of the wicked. He does not sit with people who mock. He delights in Yahweh's law. He thinks about it day and night.

He is like a tree planted by streams of water. It gives its fruit in its season. Its leaf does not dry up. The wicked are not like that. They are like chaff that the wind blows away. Yahweh knows the way of the righteous.

Memory Verse

“He will be like a tree planted by the streams of water, that produces its fruit in its season, whose leaf also does not wither. Whatever he does shall prosper.”

Psalms 1:3 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What does the blessed man delight in?

    Day and nightThe way of the righteousYahweh's law

  2. When does he think about God's law?

    Yahweh's lawThe way of the righteousDay and night

  3. What is he like?

  4. What are the wicked like?

  5. Whose way does Yahweh know?

Word Search

Find and circle each word. Words go across and down.

GLAWBMFEDVBLALERIUMRLTEUUCNYWUEREITDOOIRSETYIESDCWSERRPMCYKAESECHAFFEYDDYKVIWIDEU
  • BLESSED
  • WICKED
  • WATER
  • FRUIT
  • CHAFF
  • TREE
  • LAW
  • WAY

Prayer

Dear God, thank You for Your good law. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you grow close to God each day?
  • Good friends help us follow God. Who helps you make good choices?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 1 · Grade 3

Two Ways to Live

Name Date

Read the Story

Psalm 1 is the first song in the book of Psalms. It shows two ways to live. The blessed man does not walk in the counsel of the wicked. He does not stand on the path of sinners or sit in the seat of scoffers.

Instead, his delight is in Yahweh's law. He meditates on it day and night. He is like a tree planted by the streams of water. It produces its fruit in its season, and its leaf does not wither.

The wicked are not so. They are like chaff, the dry husks that the wind drives away. They will not stand in the judgment. Yahweh knows the way of the righteous, but the way of the wicked shall perish.

Memory Verse

“For Yahweh knows the way of the righteous, but the way of the wicked shall perish.”

Psalms 1:6 (WEB)

Answer the Questions

  1. Where does the blessed man not sit?

  2. What does he do with Yahweh's law?

  3. Where is the tree planted?

  4. What is chaff?

  5. What will happen to the way of the wicked?

Two Paths

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

YPBWRFKIGWFPLANVRACIRLETEEEPOCUVSELIWMDKIWSRKLAEGETBECAOYAJDPGDWBNTREEKRPEAJCHAFF
  • BLESSED
  • WICKED
  • WATER
  • FRUIT
  • CHAFF
  • TREE
  • LAW
  • WAY

Prayer

Dear God, thank You for Your good law. Help me . Amen.

Take It Home

For families: talk about these together.

  • A healthy tree gives fruit at the right time. What good fruit can your life show, like kindness or patience?
  • Psalm 1 shows two different paths. What choice will help you walk God's way today?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 1 · Grade 4

The Blessed Way

Name Date

Read and Think

Psalm 1 opens the whole book of Psalms with a picture of two paths. It has no title. The blessed man does not walk in the counsel of the wicked, stand on the path of sinners, or sit in the seat of scoffers. Notice the steps: walking, then standing, then sitting.

Instead, his delight is in Yahweh's law, and he meditates on it day and night. He is like a tree planted by the streams of water, which produces its fruit in its season, and whose leaf does not wither. Whatever he does shall prosper.

The wicked are not so. They are like chaff, the light husks that blow away when grain is cleaned. They will not stand in the judgment or in the congregation of the righteous. The psalm ends by saying that Yahweh knows the way of the righteous, but the way of the wicked shall perish.

Show What You Know

  1. What three things does the blessed man not do?

  2. What is his delight?

  3. What picture describes the blessed man?

  4. What does Yahweh know?

Word Bank Fill-In

Use the word bank to fill in each blank.

waychafftreewickedblessed
  1. The man does not walk in the counsel of the wicked, stand on the path of sinners, or sit in the seat of scoffers.
  2. He is like a planted by the streams of water, which produces its fruit in its season, and whose leaf does not wither.
  3. The are not so.
  4. They are like , the light husks that blow away when grain is cleaned.
  5. The psalm ends by saying that Yahweh knows the of the righteous, but the way of the wicked shall perish.

Think About It

  1. The tree has water all the time. How can you spend time with God's Word each day?

  2. Psalm 1 says the blessed man does not sit with scoffers. How can you choose good friends?

Memory Verse

“He will be like a tree planted by the streams of water, that produces its fruit in its season, whose leaf also does not wither. Whatever he does shall prosper.”

Psalms 1:3 (WEB)

Copy It

Prayer

Dear God, thank You for Your good law. Help me . Amen.

Take It Home

For families: talk about these together.

  • What two ways does Psalm 1 show?
  • How can you choose what you watch and listen to?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Psalms 1 · Grade 5

Rooted in God's Word

Name Date

Read and Think

Psalm 1 serves as a doorway into the Psalms. It has no title, and it begins with a blessing on the man who doesn't walk in the counsel of the wicked. The psalm traces a slide from walking with the wicked, to standing with sinners, to sitting among scoffers.

His delight is in Yahweh's law, and he meditates on it day and night. To meditate is to think deeply about God's words. The psalm compares him to a tree planted by the streams of water, which produces its fruit in its season and whose leaf does not wither. The tree does not make its own water; it is planted where water flows.

The wicked are like chaff which the wind drives away, and they will not stand in the judgment. The psalm closes with two endings: Yahweh knows the way of the righteous, but the way of the wicked shall perish. In the New Testament, Jesus calls himself the vine and says that the branch that remains in him bears much fruit (John 15:5).

Show What You Know

  1. How does the psalm describe a slide into sin?

  2. What does it mean to meditate on God's law?

  3. Where does the tree get its water?

  4. What New Testament picture connects to the fruitful tree?

Crossword

42135

Across

  1. On his ____ he meditates day and night.
  2. That produces its ____ in its season.
  3. But the way of the ____ shall perish.

Down

  1. He will be like a tree planted by the streams of ____.
  2. He will be like a ____ planted by the streams of water.

Think About It

  1. The tree is planted where water flows. What helps keep you close to God's Word?

  2. Psalm 1 says Yahweh knows the way of the righteous. How does it help you to know that God sees your path?

Memory Verse

“He will be like a tree planted by the streams of water, that produces its fruit in its season, whose leaf also does not wither. Whatever he does shall prosper.”

Psalms 1:3 (WEB)

Copy It

Prayer

Dear God, thank You for Your good law. Help me . Amen.

Take It Home

For families: talk about these together.

  • Psalm 1 compares the wicked to chaff the wind blows away. What habits help you grow deep roots instead?
  • How should God's final verdict shape the way you pray for friends who reject Him?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.