The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 1

Prints on letter paper in black and white. No answers are printed on the student sheet.

Psalms 1 · Grade 2

Like a Tree

Name Date

Read the Story

Psalm 1 tells about a blessed man. He does not walk in the counsel of the wicked. He does not sit with people who mock. He delights in Yahweh's law. He thinks about it day and night.

He is like a tree planted by streams of water. It gives its fruit in its season. Its leaf does not dry up. The wicked are not like that. They are like chaff that the wind blows away. Yahweh knows the way of the righteous.

Memory Verse

“He will be like a tree planted by the streams of water, that produces its fruit in its season, whose leaf also does not wither. Whatever he does shall prosper.”

Psalms 1:3 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What does the blessed man delight in?

    Day and nightThe way of the righteousYahweh's law

  2. When does he think about God's law?

    Yahweh's lawThe way of the righteousDay and night

  3. What is he like?

  4. What are the wicked like?

  5. Whose way does Yahweh know?

Word Search

Find and circle each word. Words go across and down.

GLAWBMFEDVBLALERIUMRLTEUUCNYWUEREITDOOIRSETYIESDCWSERRPMCYKAESECHAFFEYDDYKVIWIDEU
  • BLESSED
  • WICKED
  • WATER
  • FRUIT
  • CHAFF
  • TREE
  • LAW
  • WAY

Prayer

Dear God, thank You for Your good law. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you grow close to God each day?
  • Good friends help us follow God. Who helps you make good choices?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.