The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 9

For teachers and parents. Prints separately from the student sheets.

Proverbs 9 · For teachers and parents

Answer Key: Two Invitations

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolWisdom's Table

housepersontreesunflower

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenCome and Eat

BREAD → picture 3HOUSE → picture 1COME → picture 4WISE → picture 2

Grade 1Wisdom's House

Wisdom built her house. → picture 4Come, eat some of my bread. → picture 3Wisdom invites everyone. → picture 1Teach a wise person, and he will learn more. → picture 5The fear of Yahweh is the beginning of wisdom. → picture 2

Order:

1. Wisdom has built her house2. Instruct a wise person, and he will be still wiser3. The fear of Yahweh is the beginning of wisdom4. The years of your life will be increased

Grade 2Come to Wisdom's House

  1. What did wisdom build? Her house (circle)
  2. What did wisdom set? Her table (circle)
  3. What does wisdom say to people? Come, eat some of my bread.
  4. Where does being wise start? With loving and honoring God
LFEARBDPJEHROPEFSLAWOWIGCUARUSILIWOHNYASLNIROIERDANSKUNACORIEYSGRBMSNRVERSVHGGSNY

Grade 3Wisdom Invites Us

  1. How many pillars does wisdom's house have? Seven
  2. What does wisdom tell the simple to leave? Their simple ways
  3. What happens when you instruct a wise person? He will be still wiser.
  4. What is the beginning of wisdom? The fear of Yahweh
1: Wisdom has built her house2: Instruct a wise person, and he will be still wiser3: The fear of Yahweh is the beginning of wisdom4: The years of your life will be increased
PILLARSPABEGINNINGBAWISERHFYELWISDOMAFEARDGCEKNVVGGIWHLEARNINGVGHOUSEOBLJYEARSVUO

Grade 4Two Feasts

  1. What did Wisdom carve out? Her seven pillars
  2. What does Wisdom say to the simple? Leave your simple ways, and live.
  3. How does a wise person respond to correction? He will love you.
  4. What is the knowledge of the Holy One? Understanding
  5. Where does the foolish woman's road lead? To death

Word bank: 1. Wisdom; 2. pillars; 3. wiser; 4. learning; 5. fear

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Wisdom or Folly

  1. Whom did Wisdom send out to call? Her maidens
  2. What brings life in this chapter? Wisdom's feast
  3. What is the difference between the wise and the mocker? Not intelligence but humility
  4. How is the foolish woman described? Loud, undisciplined, and knows nothing
  5. What does the foolish woman hide? The cost
5HOUSE2PILLAR4BEGNNING1YARS3WSER

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.