The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 9

Every grade prints starting on a new page. No answers are included.

Proverbs 9 · Preschool

Wisdom's Table

Name Date

Color the table full of bread! Wisdom invites us in.

Can you find these in the picture? Circle each one!

Bible Verse

“The fear of Yahweh is the beginning of wisdom. The knowledge of the Holy One is understanding.”

Proverbs 9:10 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: In Proverbs, wisdom is like a lady who makes a big meal and invites everyone to come. God invites us to learn from Him. Let's say, Yes, God, I want to learn from You!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Proverbs 9 · Kindergarten

Come and Eat

Name Date

Trace the Words

Trace each word with your pencil.

COME
BREAD
HOUSE
WISE
The fear of Yahweh is the beginning of wisdom. The knowledge of the Holy One is understanding.

Proverbs 9:10 (WEB)

Match the Pictures

Draw a line from each word to its picture.

BREAD
HOUSE
COME
WISE

Mini Maze

Help find the way through the maze.

Draw It

Draw a house with seven pillars.

Prayer

Dear God, thank You for the beginning of wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did wisdom make for her guests?
  • Who invites us to learn from Him?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Proverbs 9 · Grade 1

Wisdom's House

Name Date

Trace the Words

Trace the words and the verse.

HOUSE
BREAD
WISE
FEAR
The fear of Yahweh is the beginning of wisdom. The knowledge of the Holy One is understanding.

Proverbs 9:10 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Wisdom built her house.
Come, eat some of my bread.
Wisdom invites everyone.
Teach a wise person, and he will learn more.
The fear of Yahweh is the beginning of wisdom.

Two Invitations

Write the number 1 to 4 in each circle to show the right order.

The fear of Yahweh is the beginning of wisdom

The years of your life will be increased

Wisdom has built her house

Instruct a wise person, and he will be still wiser

Draw a house with seven pillars.

Memory Verse

“The fear of Yahweh is the beginning of wisdom. The knowledge of the Holy One is understanding.”

Proverbs 9:10 (WEB)

Prayer

Dear God, thank You for the beginning of wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you learn from good advice?
  • What good food do you like to share?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Proverbs 9 · Grade 2

Come to Wisdom's House

Name Date

Read the Story

Proverbs says wisdom is like a lady who builds a house. She makes a big meal and sets her table.

She calls out to people to come in. She says, Come, eat some of my bread. She wants them to learn and live.

Proverbs says, The fear of Yahweh is the beginning of wisdom. Being wise starts with loving and honoring God.

Memory Verse

“The fear of Yahweh is the beginning of wisdom. The knowledge of the Holy One is understanding.”

Proverbs 9:10 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did wisdom build?

    Come, eat some of my breadHer tableHer house

  2. What did wisdom set?

    Her tableHer houseCome, eat some of my bread

  3. What does wisdom say to people?

  4. Where does being wise start?

Word Search

Find and circle each word. Words go across and down.

LFEARBDPJEHROPEFSLAWOWIGCUARUSILIWOHNYASLNIROIERDANSKUNACORIEYSGRBMSNRVERSVHGGSNY
  • BEGINNING
  • LEARNING
  • PILLARS
  • WISDOM
  • HOUSE
  • WISER
  • YEARS
  • FEAR

Prayer

Dear God, thank You for the beginning of wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • How many pillars did wisdom carve?
  • What happens when you teach a wise person?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Proverbs 9 · Grade 3

Wisdom Invites Us

Name Date

Read the Story

Wisdom has built her house. She has carved out her seven pillars. She has also set her table. She calls from the highest places of the city.

She says, Whoever is simple, let him turn in here! Come, eat some of my bread. Leave your simple ways, and live. Walk in the way of understanding.

A wise person likes to be taught. Instruct a wise person, and he will be still wiser. The fear of Yahweh is the beginning of wisdom. The knowledge of the Holy One is understanding.

Memory Verse

“The fear of Yahweh is the beginning of wisdom. The knowledge of the Holy One is understanding.”

Proverbs 9:10 (WEB)

Answer the Questions

  1. How many pillars does wisdom's house have?

  2. What does wisdom tell the simple to leave?

  3. What happens when you instruct a wise person?

  4. What is the beginning of wisdom?

Two Invitations

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

PILLARSPABEGINNINGBAWISERHFYELWISDOMAFEARDGCEKNVVGGIWHLEARNINGVGHOUSEOBLJYEARSVUO
  • BEGINNING
  • LEARNING
  • PILLARS
  • WISDOM
  • HOUSE
  • WISER
  • YEARS
  • FEAR

Prayer

Dear God, thank You for the beginning of wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • Whose invitation will you choose?
  • Why is it wise to be thankful when someone corrects you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Proverbs 9 · Grade 4

Two Feasts

Name Date

Read and Think

The chapter pictures two women inviting people to dinner. First, Wisdom has built her house. She has carved out her seven pillars. She has prepared her meat and set her table. She calls, Whoever is simple, let him turn in here! Come, eat some of my bread. Leave your simple ways, and live. Walk in the way of understanding.

In the middle are sayings about correction. Don't reprove a scoffer, lest he hate you. Reprove a wise person, and he will love you. Instruct a wise person, and he will be still wiser. Teach a righteous person, and he will increase in learning. Then the key verse: The fear of Yahweh is the beginning of wisdom. The knowledge of the Holy One is understanding.

Second, the foolish woman also calls from a seat in the high places of the city. She knows nothing, but she invites the simple too. She says that stolen things taste sweet. But those who go to her house do not know that her road leads to death. Two voices call. Each person must choose which invitation to accept. In the New Testament, Jesus says, I am the bread of life (John 6:35).

Show What You Know

  1. What did Wisdom carve out?

  2. What does Wisdom say to the simple?

  3. How does a wise person respond to correction?

  4. What is the knowledge of the Holy One?

  5. Where does the foolish woman's road lead?

Word Bank Fill-In

Use the word bank to fill in each blank.

wiserlearningpillarsWisdomfear
  1. First, has built her house.
  2. She has carved out her seven .
  3. Instruct a wise person, and he will be still .
  4. Teach a righteous person, and he will increase in .
  5. Then the key verse: The of Yahweh is the beginning of wisdom.

Think About It

  1. A wise person loves correction, but a scoffer hates it. How do you usually respond when someone corrects you?

  2. Two voices call out in this chapter. How can you tell the voice of wisdom from the voice of foolishness?

Memory Verse

“The fear of Yahweh is the beginning of wisdom. The knowledge of the Holy One is understanding.”

Proverbs 9:10 (WEB)

Copy It

Prayer

Dear God, thank You for the beginning of wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you say no when doing wrong seems fun?
  • In the New Testament, what does Jesus say He is?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Proverbs 9 · Grade 5

Wisdom or Folly

Name Date

Read and Think

Chapter 9 closes the first section of Proverbs with two banquets. Wisdom has built her house. She has carved out her seven pillars. She has set her table and sent out her maidens to call: Whoever is simple, let him turn in here! Come, eat some of my bread, Drink some of the wine which I have mixed! Leave your simple ways, and live. Wisdom's feast brings life.

Between the two feasts is a section on teachability. One who corrects a mocker invites insult. Reprove a wise person, and he will love you. Instruct a wise person, and he will be still wiser. The difference between the wise and the mocker is not intelligence but humility. The key verse returns to the book's theme: The fear of Yahweh is the beginning of wisdom. The knowledge of the Holy One is understanding. If you are wise, you are wise for yourself. If you mock, you alone will bear it.

The foolish woman is loud, undisciplined, and knows nothing. She copies Wisdom's invitation word for word, Whoever is simple, let him turn in here, but offers stolen pleasures: Stolen water is sweet. Food eaten in secret is pleasant. But he doesn't know that the departed spirits are there. Folly promises pleasure and hides the cost. In the New Testament, Jesus says, I am the bread of life (John 6:35).

Show What You Know

  1. Whom did Wisdom send out to call?

  2. What brings life in this chapter?

  3. What is the difference between the wise and the mocker?

  4. How is the foolish woman described?

  5. What does the foolish woman hide?

Crossword

52413

Across

  1. The fear of Yahweh is the ____ of wisdom
  2. Wisdom has built her ____

Down

  1. The ____ of your life will be increased
  2. She has carved out her seven ____
  3. and he will be still ____

Think About It

  1. Folly copies Wisdom's invitation word for word. How can something wrong look a lot like something good?

  2. The difference between the wise and the mocker is humility. How can you grow in humility this week?

Memory Verse

“The fear of Yahweh is the beginning of wisdom. The knowledge of the Holy One is understanding.”

Proverbs 9:10 (WEB)

Copy It

Prayer

Dear God, thank You for the beginning of wisdom. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does folly hide the cost?
  • How can you be teachable this week?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.