The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 36

For teachers and parents. Prints separately from the student sheets.

Numbers 36 · For teachers and parents

Answer Key: The Daughters' Inheritance Kept

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolWise Daughters Obey

peoplemountainscrollhouseheart

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenObey God

SISTERS → picture 2LAND → picture 4OBEY → picture 1RULE → picture 3

Grade 1Five Sisters Obey

The leaders asked Moses. → picture 2God gave a rule. → picture 4The sisters obeyed. → picture 5The land stayed. → picture 1The book ends. → picture 3

Order:

1. Leaders ask Moses2. Moses asks God3. God gives a rule4. The land stays in the tribe

Grade 2The Sisters Obey God

  1. How many sisters were there? Five (circle)
  2. Who asked Moses a question? The leaders of their family
  3. Who did Moses ask? God (circle)
  4. Who could the sisters marry? Anyone they wanted from their own tribe
  5. What did the sisters do? They obeyed God. (circle)
URCLYHYCDTRIBEGVOAFSEMOABMUKAGWASUMGENMHOBVAHEMRIGTKNTPDETLKFDEMLANDYRERFMARRIEDS

Grade 3The Inheritance Stays

  1. Who came to Moses? The heads of the families of Gilead
  2. What were they worried about? The land would move to another tribe.
  3. How did Moses answer? By the word of Yahweh
  4. Who could the daughters marry? Whom they thought best, within their father's tribe
  5. Where did their inheritance stay? In their father's tribe
1: Leaders ask Moses2: Moses asks God3: God gives a rule4: The land stays in the tribe
IPLANDNIAMTIPBMIPTCOMMANDEDDCTRIBEHICYMRPDMGWVMARRIEDFDAUGHTERSKEEPHMOABCSBFAMILY

Grade 4A Fair Ending

  1. In which chapter did the daughters first receive land? Numbers 27
  2. What was the new concern? Their land would pass to other tribes.
  3. Whom did God's answer protect? Both the daughters and their tribe
  4. How does Numbers begin? With a census in the wilderness

Word bank: 1. God; 2. tribe; 3. married; 4. land

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5An Inheritance Kept

  1. What was the clan's concern? The daughters' inheritance would be added to another tribe.
  2. What did Moses say about the tribe of Joseph? They speak what is right.
  3. What principle followed? No inheritance would move from tribe to tribe.
  4. Whom did the daughters marry? Their father's brothers' sons
  5. How does 1 Peter 1:4 describe our inheritance? Incorruptible, undefiled, unfading, reserved in heaven
6TRIBE1INHERI4MOA3OBY2MAASSEH5NAH

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.