The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 36

Every grade prints starting on a new page. No answers are included.

Numbers 36 · Preschool

Wise Daughters Obey

Name Date

Color the five sisters! They obeyed God.

Can you find these in the picture? Circle each one!

Bible Verse

Moses commanded the children of Israel according to Yahweh’s word, saying, “The tribe of the sons of Joseph speak what is right.

Numbers 36:5 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: These sisters listened to God and obeyed. We can obey God too.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Numbers 36 · Kindergarten

Obey God

Name Date

Trace the Words

Trace each word with your pencil.

OBEY
GOD
LAND
FAMILY
Moses commanded the children of Israel according to Yahweh’s word, saying, “The tribe of the sons of Joseph speak what is right.

Numbers 36:5 (WEB)

Match the Pictures

Draw a line from each word to its picture.

SISTERS
LAND
OBEY
RULE

Mini Maze

Help find the way through the maze.

Draw It

Draw a gift from God you want to keep.

Prayer

Dear God, thank You for my inheritance in Jesus. Help me . Amen.

Take It Home

For families: talk about these together.

  • What is a gift you would like to keep?
  • How many sisters were there?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Numbers 36 · Grade 1

Five Sisters Obey

Name Date

Trace the Words

Trace the words and the verse.

FIVE
OBEY
LAND
TRIBE
Moses commanded the children of Israel according to Yahweh’s word, saying, “The tribe of the sons of Joseph speak what is right.

Numbers 36:5 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

The leaders asked Moses.
God gave a rule.
The sisters obeyed.
The land stayed.
The book ends.

The Land Stays

Write the number 1 to 4 in each circle to show the right order.

Moses asks God

God gives a rule

The land stays in the tribe

Leaders ask Moses

Draw a gift from God you want to keep.

Memory Verse

Moses commanded the children of Israel according to Yahweh’s word, saying, “The tribe of the sons of Joseph speak what is right.

Numbers 36:5 (WEB)

Prayer

Dear God, thank You for my inheritance in Jesus. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who asked Moses a question?
  • Who did the sisters marry?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Numbers 36 · Grade 2

The Sisters Obey God

Name Date

Read the Story

Do you remember the five sisters? God gave them their father's land. Now the leaders of their family had a question.

They asked Moses, What if the sisters marry men from other tribes? Then the land will go to other tribes. Moses asked God.

God said the sisters could marry anyone they wanted from their own tribe. Then the land would stay in the family. The sisters obeyed God. That is how the book of Numbers ends.

Memory Verse

Moses commanded the children of Israel according to Yahweh’s word, saying, “The tribe of the sons of Joseph speak what is right.

Numbers 36:5 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. How many sisters were there?

    GodFiveThey obeyed God

  2. Who asked Moses a question?

  3. Who did Moses ask?

    GodFiveThey obeyed God

  4. Who could the sisters marry?

  5. What did the sisters do?

    They obeyed GodFiveGod

Word Search

Find and circle each word. Words go across and down.

URCLYHYCDTRIBEGVOAFSEMOABMUKAGWASUMGENMHOBVAHEMRIGTKNTPDETLKFDEMLANDYRERFMARRIEDS
  • COMMANDED
  • DAUGHTERS
  • MARRIED
  • FAMILY
  • TRIBE
  • LAND
  • MOAB
  • KEEP

Prayer

Dear God, thank You for my inheritance in Jesus. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you obey even when you have to make a choice?
  • Why did God keep the land in each tribe?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Numbers 36 · Grade 3

The Inheritance Stays

Name Date

Read the Story

The heads of the families of Gilead came to Moses. They said, God commanded that Zelophehad's land be given to his daughters. But if they marry men of another tribe, the land will move to that tribe.

Moses answered by the word of Yahweh. The tribe of Joseph speaks what is right, he said. The daughters may marry whom they think best, but only within their father's tribe. No inheritance would move from tribe to tribe.

Mahlah, Tirzah, Hoglah, Milcah, and Noah did as Yahweh commanded Moses. They married into the families of Manasseh. Their inheritance stayed in their father's tribe.

Memory Verse

Moses commanded the children of Israel according to Yahweh’s word, saying, “The tribe of the sons of Joseph speak what is right.

Numbers 36:5 (WEB)

Answer the Questions

  1. Who came to Moses?

  2. What were they worried about?

  3. How did Moses answer?

  4. Who could the daughters marry?

  5. Where did their inheritance stay?

The Land Stays

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

IPLANDNIAMTIPBMIPTCOMMANDEDDCTRIBEHICYMRPDMGWVMARRIEDFDAUGHTERSKEEPHMOABCSBFAMILY
  • COMMANDED
  • DAUGHTERS
  • MARRIED
  • FAMILY
  • TRIBE
  • LAND
  • MOAB
  • KEEP

Prayer

Dear God, thank You for my inheritance in Jesus. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did Moses say the sisters could do?
  • Why did the leaders worry about the land?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Numbers 36 · Grade 4

A Fair Ending

Name Date

Read and Think

In Numbers 27, God gave Zelophehad's daughters their father's land. Now their relatives raised a new concern. If the daughters married into other tribes, their land would pass to those tribes, and Manasseh's portion would shrink.

Moses brought the question to God and gave His answer. The daughters were free to marry whom they chose, as long as their husbands were from their own tribe. That way, each tribe's inheritance stayed whole. God's answer protected both the daughters and their tribe.

The five sisters obeyed and married their cousins. So Numbers ends with a family trusting God's word. Numbers began with a census in the wilderness and ends with a new generation ready to enter the land.

Show What You Know

  1. In which chapter did the daughters first receive land?

  2. What was the new concern?

  3. Whom did God's answer protect?

  4. How does Numbers begin?

Word Bank Fill-In

Use the word bank to fill in each blank.

tribeGodmarriedland
  1. Moses brought the question to and gave His answer.
  2. The daughters were free to marry whom they chose, as long as their husbands were from their own .
  3. The five sisters obeyed and their cousins.
  4. Numbers began with a census in the wilderness and ends with a new generation ready to enter the .

Think About It

  1. How did God's answer show care for everyone?

  2. What have you learned about God from the book of Numbers?

Memory Verse

“So shall no inheritance of the children of Israel move from tribe to tribe; for the children of Israel shall all keep the inheritance of the tribe of his fathers.”

Numbers 36:7 (WEB)

Copy It

Prayer

Dear God, thank You for my inheritance in Jesus. Help me . Amen.

Take It Home

For families: talk about these together.

  • How has God kept His promises to your family?
  • What inheritance do we have in Jesus?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Numbers 36 · Grade 5

An Inheritance Kept

Name Date

Read and Think

The book of Numbers ends by returning to Zelophehad's daughters. The heads of the clan of Gilead, from Manasseh, came before Moses and the princes. They pointed out that if the daughters married into another tribe, their inheritance would be added to that tribe. Even at the Jubilee, the land would not return. Their concern was not to undo the daughters' rights but to keep the tribe's portion whole.

Moses commanded according to the word of Yahweh: The tribe of the sons of Joseph speak what is right. Let them be married to whom they think best, only they shall marry into the family of the tribe of their father. The principle followed: So shall no inheritance of the children of Israel move from tribe to tribe; for the children of Israel shall all keep the inheritance of the tribe of his fathers. Every daughter who inherited land would follow the same rule.

Mahlah, Tirzah, Hoglah, Milcah, and Noah did as Yahweh commanded Moses and married their father's brothers' sons. The book closes: These are the commandments and the ordinances which Yahweh commanded by Moses to the children of Israel in the plains of Moab by the Jordan at Jericho. Numbers began with an unbelieving generation and ends with obedient daughters on the edge of promise. Believers have an inheritance incorruptible, undefiled, and that doesn't fade away, reserved in heaven (1 Peter 1:4).

Show What You Know

  1. What was the clan's concern?

  2. What did Moses say about the tribe of Joseph?

  3. What principle followed?

  4. Whom did the daughters marry?

  5. How does 1 Peter 1:4 describe our inheritance?

Crossword

614325

Across

  1. Their father's tribe.
  2. What the sisters did.
  3. One of the five sisters.
  4. The land stayed in the ____.

Down

  1. To receive as a gift from family.
  2. Where Numbers ends: the plains of ____.

Think About It

  1. How does Numbers show both God's judgment and His faithfulness?

  2. What does it mean to have an inheritance kept in heaven?

Memory Verse

“So shall no inheritance of the children of Israel move from tribe to tribe; for the children of Israel shall all keep the inheritance of the tribe of his fathers.”

Numbers 36:7 (WEB)

Copy It

Prayer

Dear God, thank You for my inheritance in Jesus. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does God's answer protect both the daughters and the tribe?
  • How can you obey God gladly when a rule seems hard?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.