The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 36

Prints on letter paper in black and white. No answers are printed on the student sheet.

Numbers 36 · Grade 2

The Sisters Obey God

Name Date

Read the Story

Do you remember the five sisters? God gave them their father's land. Now the leaders of their family had a question.

They asked Moses, What if the sisters marry men from other tribes? Then the land will go to other tribes. Moses asked God.

God said the sisters could marry anyone they wanted from their own tribe. Then the land would stay in the family. The sisters obeyed God. That is how the book of Numbers ends.

Memory Verse

Moses commanded the children of Israel according to Yahweh’s word, saying, “The tribe of the sons of Joseph speak what is right.

Numbers 36:5 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. How many sisters were there?

    GodFiveThey obeyed God

  2. Who asked Moses a question?

  3. Who did Moses ask?

    GodFiveThey obeyed God

  4. Who could the sisters marry?

  5. What did the sisters do?

    They obeyed GodFiveGod

Word Search

Find and circle each word. Words go across and down.

URCLYHYCDTRIBEGVOAFSEMOABMUKAGWASUMGENMHOBVAHEMRIGTKNTPDETLKFDEMLANDYRERFMARRIEDS
  • COMMANDED
  • DAUGHTERS
  • MARRIED
  • FAMILY
  • TRIBE
  • LAND
  • MOAB
  • KEEP

Prayer

Dear God, thank You for my inheritance in Jesus. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you obey even when you have to make a choice?
  • Why did God keep the land in each tribe?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.