The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 29

Prints on letter paper in black and white. No answers are printed on the student sheet.

Numbers 29 · Grade 2

Happy Holy Days

Name Date

Read the Story

In the fall, God's people had special days. On the first day of the seventh month, they blew trumpets. It was a day to stop work and worship God.

On the tenth day, they did not eat. They told God they were sorry for their sins. It was the Day of Atonement.

On the fifteenth day, a big feast began. It lasted seven days, and then one more day. They gave many gifts to God. It was a happy time to thank God.

Memory Verse

“‘On the fifteenth day of the seventh month you shall have a holy convocation. You shall do no regular work. You shall keep a feast to Yahweh seven days.

Numbers 29:12 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did they blow on the first day?

    The Day of AtonementTrumpetsA happy time to thank God

  2. What did they tell God on the tenth day?

  3. What was the tenth day called?

    A happy time to thank GodThe Day of AtonementTrumpets

  4. How long did the big feast last?

  5. What kind of time was the feast?

Word Search

Find and circle each word. Words go across and down.

GFLYTIALAOIHSRFTEEAFOEUIOIBFTLVMLNGUFEYEPDEHFLEWNETMTEINRTTGEHACTMHNTNESTHKBJDTJT
  • FIFTEENTH
  • ATONEMENT
  • TRUMPET
  • SEVENTH
  • AFFLICT
  • EIGHTH
  • FEAST
  • HOLY

Prayer

Dear God, thank You for times of joy. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does it feel to begin again with God?
  • Why were there so many offerings?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.