The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 29

For teachers and parents. Prints separately from the student sheets.

Numbers 29 · For teachers and parents

Answer Key: The Fall Feasts

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolThe Trumpet Feast

ln and boothtrumpetaltarwheatpeople

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenFeast Days

TRUMPET → picture 3BOOTH → picture 1JOY → picture 4LAMB → picture 2

Grade 1Three Fall Feasts

Day of Trumpets. → picture 4Day of Atonement. → picture 3Feast of Booths. → picture 1It lasted seven days. → picture 5Then one more day. → picture 2

Order:

1. Day of Trumpets2. Day of Atonement3. Feast of Booths4. A last holy day

Grade 2Happy Holy Days

  1. What did they blow on the first day? Trumpets (circle)
  2. What did they tell God on the tenth day? They were sorry for their sins.
  3. What was the tenth day called? The Day of Atonement (circle)
  4. How long did the big feast last? Seven days, then one more day
  5. What kind of time was the feast? A happy time to thank God
GFLYTIALAOIHSRFTEEAFOEUIOIBFTLVMLNGUFEYEPDEHFLEWNETMTEINRTTGEHACTMHNTNESTHKBJDTJT

Grade 3Trumpets, Atonement, and Booths

  1. What happened on the first day of the seventh month? A day of blowing of trumpets
  2. What did the people do on the tenth day? They afflicted their souls and did no work.
  3. How many bulls were offered on the first day of the feast? Thirteen
  4. What happened each day after that? One fewer bull was offered.
  5. What was the eighth day? A solemn assembly
1: Day of Trumpets2: Day of Atonement3: Feast of Booths4: A last holy day
SANCEAFOYEFFIJTIBTVFKEHOFGRELKIONTKUNILGLEEFMTCHHYMEEPHTKTRENAEOYKHJNTSTICCDKTHTA

Grade 4A Month of Worship

  1. What called God's people to remember Him? The trumpet blasts on the Day of Trumpets
  2. Where is the Day of Atonement described fully? Leviticus 16
  3. How many bulls in total were offered in the seven days? Seventy
  4. What came before joy in the seventh month? Sorrow for sin

Word bank: 1. holy; 2. Atonement; 3. fifteenth

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5From Trumpets to Booths

  1. How did the offerings in the seventh month relate to daily and monthly offerings? They were added on top, so worship built in layers.
  2. What happened on the tenth day? A holy convocation when the people would afflict their souls, the Day of Atonement
  3. What does Hebrews 9:12 say Christ obtained? Eternal redemption
  4. How many bulls in all over the seven days? Seventy
  5. What did Jesus cry out at this feast? If anyone is thirsty, let him come to me and drink.
6SEVENTY2THIRTEN5BOOHS1AONEMEN3T4ASSMBLYRUMPETS

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.