The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 1

For teachers and parents. Prints separately from the student sheets.

Nehemiah 1 · For teachers and parents

Answer Key: Nehemiah Prays for Jerusalem

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolNehemiah Prays

cupcrownheart

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenPray First

PRAY → picture 3WALL → picture 1CUP → picture 4KING → picture 2

Grade 1Sad News

Men came from Jerusalem with news. → picture 4The wall of the city was broken. → picture 3The gates had been burned. → picture 1Nehemiah prayed to God. → picture 5Nehemiah served the king his cup. → picture 2

Order:

1. The wall of Jerusalem is also broken down2. I sat down and wept, and mourned several days3. who keeps covenant and loving kindness4. Now I was cup bearer to the king

Grade 2Nehemiah Hears Sad News

  1. Who did Nehemiah serve? A king (circle)
  2. Where did the men come from? Jerusalem (circle)
  3. What was wrong with the wall? It was down. (circle)
  4. What did Nehemiah do when he was sad? He prayed to God. (circle)
  5. Who did he want help to talk to? The king (circle)
TCBEARERVHOPBROKENEVRRKUCISSERVANTJLLNNOHSJLCCAHKINGSKLNIBWEPTRKTVPRAYEDLLUKSWALL

Grade 3A Prayer for the City

  1. What was Nehemiah's job? He was the cupbearer to the king.
  2. What news did Hanani bring? The people were in trouble, the wall was broken, and the gates were burned.
  3. What did Nehemiah do first? He sat down, wept, fasted, and prayed.
  4. What did Nehemiah say about God? That He is great and keeps His promises
  5. What did he ask God to do at the end? Help him when he went to the king
1: The wall of Jerusalem is also broken down2: I sat down and wept, and mourned several days3: who keeps covenant and loving kindness4: Now I was cup bearer to the king
WWKGCBVOMEAUMORMRIPBPWVOUSITERAEKIEFMAALNEDRTIRYLANTVCEEENNDRAPIRDWTOSNUBKINGMRTW

Grade 4Prayer Comes First

  1. What job did Nehemiah have? He was the king's cupbearer.
  2. Why was a broken wall a problem? The city was open to any enemy.
  3. What did Nehemiah do for many days? He wept, mourned, fasted, and prayed.
  4. Whose sins did Nehemiah confess? The people's sins and his own family's
  5. What did he ask God for at the end? Mercy before the king

Word bank: 1. king; 2. wall; 3. wept; 4. prayed; 5. covenant

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5A Burden Turned to Prayer

  1. What position did Nehemiah hold? He was cupbearer to King Artaxerxes.
  2. What did the men report about the survivors? They were in great affliction and reproach.
  3. How did Nehemiah respond to the news? He wept, mourned, fasted, and prayed for days.
  4. How did his prayer begin? With worship of the great and awesome God
  5. What promise did he remind God of? His promise to gather His scattered people
5WALL3COVENNT4BARER2PRAYD1WET

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.