The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 1

Every grade prints starting on a new page. No answers are included.

Nehemiah 1 · Preschool

Nehemiah Prays

Name Date

Color Nehemiah praying to God. He told God about his sad news!

Can you find these in the picture? Circle each one!

Bible Verse

“Now these are your servants and your people, whom you have redeemed by your great power and by your strong hand.

Nehemiah 1:10 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Nehemiah heard sad news about God's city. First, he prayed. We can tell God when we are sad, and He hears us.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Nehemiah 1 · Kindergarten

Pray First

Name Date

Trace the Words

Trace each word with your pencil.

PRAY
WALL
GOD
HEAR
“Now these are your servants and your people, whom you have redeemed by your great power and by your strong hand.

Nehemiah 1:10 (WEB)

Match the Pictures

Draw a line from each word to its picture.

PRAY
WALL
CUP
KING

Mini Maze

Help find the way through the maze.

Draw It

Draw someone praying for another person.

Prayer

Dear God, thank You for hearing my prayers. Help me . Amen.

Take It Home

For families: talk about these together.

  • What makes you sad?
  • What can you ask God to help with?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Nehemiah 1 · Grade 1

Sad News

Name Date

Trace the Words

Trace the words and the verse.

PRAYED
WALL
GATES
HEAVEN
“Now these are your servants and your people, whom you have redeemed by your great power and by your strong hand.

Nehemiah 1:10 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Men came from Jerusalem with news.
The wall of the city was broken.
The gates had been burned.
Nehemiah prayed to God.
Nehemiah served the king his cup.

Nehemiah Hears Sad News

Write the number 1 to 4 in each circle to show the right order.

I sat down and wept, and mourned several days

who keeps covenant and loving kindness

Now I was cup bearer to the king

The wall of Jerusalem is also broken down

Draw someone praying for another person.

Memory Verse

“Now these are your servants and your people, whom you have redeemed by your great power and by your strong hand.

Nehemiah 1:10 (WEB)

Prayer

Dear God, thank You for hearing my prayers. Help me . Amen.

Take It Home

For families: talk about these together.

  • What sad news did Nehemiah hear?
  • What can you do when you feel sad?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Nehemiah 1 · Grade 2

Nehemiah Hears Sad News

Name Date

Read the Story

Nehemiah lived far from home. He served a king. One day some men came from Jerusalem. Nehemiah asked them how it was.

They had sad news. The wall of the city was down. The gates were burned. The people were in trouble.

Nehemiah sat down and cried. He did not eat. He prayed to God for days. He asked God to help him talk to the king.

Memory Verse

“Now these are your servants and your people, whom you have redeemed by your great power and by your strong hand.

Nehemiah 1:10 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who did Nehemiah serve?

    The kingHe prayed to GodA king

  2. Where did the men come from?

    A kingJerusalemIt was down

  3. What was wrong with the wall?

    JerusalemIt was downHe prayed to God

  4. What did Nehemiah do when he was sad?

    He prayed to GodJerusalemA king

  5. Who did he want help to talk to?

    A kingThe kingIt was down

Word Search

Find and circle each word. Words go across and down.

TCBEARERVHOPBROKENEVRRKUCISSERVANTJLLNNOHSJLCCAHKINGSKLNIBWEPTRKTVPRAYEDLLUKSWALL
  • COVENANT
  • SERVANT
  • BROKEN
  • PRAYED
  • BEARER
  • WALL
  • WEPT
  • KING

Prayer

Dear God, thank You for hearing my prayers. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you care about people who live far away?
  • How do you feel when you hear sad news about people you love?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Nehemiah 1 · Grade 3

A Prayer for the City

Name Date

Read the Story

Nehemiah was the cupbearer to the king. He lived in the city of Susa. His brother Hanani came from Judah with some men. Nehemiah asked about the Jews and about Jerusalem.

They told him the people were in great trouble. The wall was broken down. The gates were burned with fire. When Nehemiah heard this, he sat down and wept. He fasted and prayed for days.

He told God that He is great and keeps His promises. He said that he and his people had sinned. He asked God to remember His promise to bring His people home. Then he asked God to help him when he went to the king.

Memory Verse

“Now these are your servants and your people, whom you have redeemed by your great power and by your strong hand.

Nehemiah 1:10 (WEB)

Answer the Questions

  1. What was Nehemiah's job?

  2. What news did Hanani bring?

  3. What did Nehemiah do first?

  4. What did Nehemiah say about God?

  5. What did he ask God to do at the end?

Nehemiah Hears Sad News

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

WWKGCBVOMEAUMORMRIPBPWVOUSITERAEKIEFMAALNEDRTIRYLANTVCEEENNDRAPIRDWTOSNUBKINGMRTW
  • COVENANT
  • SERVANT
  • BROKEN
  • PRAYED
  • BEARER
  • WALL
  • WEPT
  • KING

Prayer

Dear God, thank You for hearing my prayers. Help me . Amen.

Take It Home

For families: talk about these together.

  • How did Nehemiah show that he cared?
  • How can you keep praying about something for many days?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Nehemiah 1 · Grade 4

Prayer Comes First

Name Date

Read and Think

Nehemiah lived in Susa, the winter palace of the Persian king. He served as the king's cupbearer. That was a job of great trust. When his brother Hanani came from Judah, Nehemiah asked about the people and the city.

The news was hard. The people who had come back were in great trouble. The wall of Jerusalem was broken down. Its gates had been burned with fire. A city without walls was open to any enemy.

Nehemiah wept and mourned for days. He fasted and prayed. He praised God, who keeps His covenant. He confessed the sins of the people and his own family. He reminded God of His promise to gather His people. Then he asked God to give him mercy before the king.

Show What You Know

  1. What job did Nehemiah have?

  2. Why was a broken wall a problem?

  3. What did Nehemiah do for many days?

  4. Whose sins did Nehemiah confess?

  5. What did he ask God for at the end?

Word Bank Fill-In

Use the word bank to fill in each blank.

wallcovenantprayedkingwept
  1. Nehemiah lived in Susa, the winter palace of the Persian .
  2. The of Jerusalem was broken down.
  3. Nehemiah and mourned for days.
  4. He fasted and .
  5. He praised God, who keeps His .

Think About It

  1. Nehemiah prayed before he made a plan. What is a problem you can bring to God in prayer first?

  2. Nehemiah said we have sinned, not just they have sinned. How can you be honest with God about your own wrongs?

Memory Verse

“Now these are your servants and your people, whom you have redeemed by your great power and by your strong hand.

Nehemiah 1:10 (WEB)

Copy It

Prayer

Dear God, thank You for hearing my prayers. Help me . Amen.

Take It Home

For families: talk about these together.

  • How did Nehemiah begin his prayer?
  • How did Nehemiah use God's promises when he prayed?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Nehemiah 1 · Grade 5

A Burden Turned to Prayer

Name Date

Read and Think

The book of Nehemiah begins about thirteen years after Ezra came to Jerusalem. Nehemiah served King Artaxerxes as cupbearer in Susa. He tasted the king's wine and stood close to him each day. It was a position of trust and influence.

When Hanani and other men came from Judah, Nehemiah asked about the remnant and about Jerusalem. They said the survivors were in great affliction and reproach. The wall was broken down, and the gates were burned. Nehemiah did not shrug off the news. He sat down, wept, mourned, fasted, and prayed for days.

His prayer is a model. He began with worship, calling God great and awesome, the God who keeps covenant and loving kindness. He confessed sin, including his own. He pleaded God's own promise in the law of Moses to gather His scattered people. Only then did he ask for something specific: success and mercy in the sight of the king.

Show What You Know

  1. What position did Nehemiah hold?

  2. What did the men report about the survivors?

  3. How did Nehemiah respond to the news?

  4. How did his prayer begin?

  5. What promise did he remind God of?

Crossword

53421

Across

  1. I sat down and ____
  2. Now I was cup ____ to the king
  3. The ____ of Jerusalem is also broken down

Down

  1. Nehemiah fasted and did this before God.
  2. God keeps this promise with His people.

Think About It

  1. Nehemiah's prayer moved from worship to confession to God's promises to a request. How could you use that pattern in your own prayers?

  2. Nehemiah was safe in a palace, yet he grieved for his people far away. Whose needs could God be asking you to care about and pray for?

Memory Verse

“Now these are your servants and your people, whom you have redeemed by your great power and by your strong hand.

Nehemiah 1:10 (WEB)

Copy It

Prayer

Dear God, thank You for hearing my prayers. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does Nehemiah teach us about praying first?
  • How can you pray for people who are in trouble?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.