The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 1

Prints on letter paper in black and white. No answers are printed on the student sheet.

Nehemiah 1 · Grade 3

A Prayer for the City

Name Date

Read the Story

Nehemiah was the cupbearer to the king. He lived in the city of Susa. His brother Hanani came from Judah with some men. Nehemiah asked about the Jews and about Jerusalem.

They told him the people were in great trouble. The wall was broken down. The gates were burned with fire. When Nehemiah heard this, he sat down and wept. He fasted and prayed for days.

He told God that He is great and keeps His promises. He said that he and his people had sinned. He asked God to remember His promise to bring His people home. Then he asked God to help him when he went to the king.

Memory Verse

“Now these are your servants and your people, whom you have redeemed by your great power and by your strong hand.

Nehemiah 1:10 (WEB)

Answer the Questions

  1. What was Nehemiah's job?

  2. What news did Hanani bring?

  3. What did Nehemiah do first?

  4. What did Nehemiah say about God?

  5. What did he ask God to do at the end?

Nehemiah Hears Sad News

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

WWKGCBVOMEAUMORMRIPBPWVOUSITERAEKIEFMAALNEDRTIRYLANTVCEEENNDRAPIRDWTOSNUBKINGMRTW
  • COVENANT
  • SERVANT
  • BROKEN
  • PRAYED
  • BEARER
  • WALL
  • WEPT
  • KING

Prayer

Dear God, thank You for hearing my prayers. Help me . Amen.

Take It Home

For families: talk about these together.

  • How did Nehemiah show that he cared?
  • How can you keep praying about something for many days?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.