The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 3

For teachers and parents. Prints separately from the student sheets.

Mark 3 · For teachers and parents

Answer Key: Jesus Chooses the Twelve

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolJesus Picks Twelve Friends

JesusMountainCrowdPersontree

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod's Family

HAND → picture 2MOUNTAIN → picture 4HOUSE → picture 1BOAT → picture 3

Grade 1Jesus' Family

Jesus healed a man's hand. → picture 4Jesus taught from a boat. → picture 5Jesus went up a mountain. → picture 2He chose twelve apostles. → picture 3Whoever obeys God is His family. → picture 1

Order:

1. Jesus healed a man's hand.2. Jesus taught from a boat.3. Jesus went up a mountain.4. He appointed twelve.5. Whoever obeys God is His family.

Grade 2Twelve Friends

  1. What was wrong with the man's hand? It did not work. (circle)
  2. What did Jesus tell the man? Stretch out your hand. (circle)
  3. Why did Jesus have a boat ready? So the crowd would not press on Him
  4. How many apostles did Jesus choose? Twelve (circle)
  5. What would the apostles do? Be with Jesus and go out to preach
PREACHCKWGVJMRLAUCVNNEDLRNSAPPOINTEDBNTWELVEMOFSABBATHADYFAMILYTFRIENDSSMMMGHPFKY

Grade 3The Family of God

  1. What did Jesus do on the Sabbath? He healed a man's withered hand.
  2. Why was Jesus sad? The leaders' hearts were so hard.
  3. Why did Jesus choose the twelve apostles? To be with Him and to preach
  4. What did Jesus say about a divided house? It cannot stand.
  5. Who did Jesus say is His family? Whoever does the will of God
1: Jesus healed a man's hand.2: Jesus taught from a boat.3: Jesus went up a mountain.4: He appointed twelve.5: Whoever obeys God is His family.

Grade 4With Him and Sent Out

  1. What question did Jesus ask before healing on the Sabbath? Is it lawful on the Sabbath day to do good or to do harm?
  2. What two purposes did Jesus have for appointing the twelve? That they might be with Him, and that He might send them out to preach
  3. What did the scribes accuse Jesus of? Casting out demons by Beelzebul (Satan's power)
  4. Whom did Jesus call His true family? Whoever does the will of God

Word bank: 1. hand; 2. Sabbath; 3. God

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Binding the Strong Man

  1. How did Jesus turn the Sabbath debate into a moral question? He asked whether it is right on the Sabbath to do good or harm, to save life or kill.
  2. What is ironic about the leaders' plotting on the Sabbath? They planned harm on the Sabbath while criticizing Jesus for doing good.
  3. What does the choosing of twelve on a mountain suggest? Jesus is forming a new Israel around Himself, like the twelve tribes, echoing Moses at Sinai.
  4. What does the parable of the strong man teach? Jesus has come to bind Satan and rescue those he held captive.
  5. How did Jesus define His true family? Not by blood, but by doing God's will
2BOAT1FMILY4TWEVE3PRACH6SABBAT5HND

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.