The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 3

Every grade prints starting on a new page. No answers are included.

Mark 3 · Preschool

Jesus Picks Twelve Friends

Name Date

Color the picture. Point to Jesus on the mountain and His twelve friends.

Can you find these in the picture? Circle each one!

Bible Verse

“He appointed twelve, that they might be with him, and that he might send them out to preach”

Mark 3:14 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Count to twelve together. Say: Jesus chose friends to be with Him. Jesus wants to be your friend too!

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Mark 3 · Kindergarten

God's Family

Name Date

Trace the Words

Trace each word with your pencil.

TWELVE
FRIENDS
FAMILY
HAND
For whoever does the will of God is my brother, my sister, and mother.”

Mark 3:35 (WEB)

Match the Pictures

Draw a line from each word to its picture.

HAND
MOUNTAIN
HOUSE
BOAT

Mini Maze

Help find the way through the maze.

Draw It

Draw your favorite part of the story: God's Family.

Prayer

Dear God, thank You for this Bible story. Help me to . Amen.

Take It Home

For families: talk about these together.

  • Jesus chose twelve friends. Who are your good friends?
  • How can you be one of Jesus' helpers?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Mark 3 · Grade 1

Jesus' Family

Name Date

Trace the Words

Trace the words and the verse.

HAND
TWELVE
APOSTLES
FAMILY
For whoever does the will of God is my brother, my sister, and mother.”

Mark 3:35 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Jesus healed a man's hand.
Jesus taught from a boat.
Jesus went up a mountain.
He chose twelve apostles.
Whoever obeys God is His family.

Put the Story in Order

Write the number 1 to 5 in each circle to show the right order.

Jesus went up a mountain.

Jesus healed a man's hand.

Jesus taught from a boat.

Whoever obeys God is His family.

He appointed twelve.

Draw your favorite part of the story: God's Family.

Memory Verse

For whoever does the will of God is my brother, my sister, and mother.”

Mark 3:35 (WEB)

Prayer

Dear God, thank You for this Bible story. Help me to . Amen.

Take It Home

For families: talk about these together.

  • Who are your good friends?
  • How can you help someone at home?
  • What would you like to say to God about this story?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Mark 3 · Grade 2

Twelve Friends

Name Date

Read the Story

One day Jesus saw a man with a hand that did not work. Jesus said, "Stretch out your hand." The man did, and his hand was made well!

So many people came to Jesus that He had a boat ready, so the crowd would not press on Him.

Jesus went up a mountain. He chose twelve men to be His apostles. They would be with Jesus. Then He would send them out to preach.

Memory Verse

“He appointed twelve, that they might be with him, and that he might send them out to preach”

Mark 3:14 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What was wrong with the man's hand?

    It did not workTwelveStretch out your hand

  2. What did Jesus tell the man?

    It did not workStretch out your handTwelve

  3. Why did Jesus have a boat ready?

  4. How many apostles did Jesus choose?

    TwelveIt did not workStretch out your hand

  5. What would the apostles do?

Word Search

Find and circle each word. Words go across and down.

PREACHCKWGVJMRLAUCVNNEDLRNSAPPOINTEDBNTWELVEMOFSABBATHADYFAMILYTFRIENDSSMMMGHPFKY
  • APPOINTED
  • FRIENDS
  • SABBATH
  • TWELVE
  • FAMILY
  • PREACH
  • HAND
  • BOAT

Prayer

Dear God, thank You for this Bible story. Help me to . Amen.

Take It Home

For families: talk about these together.

  • Jesus said people who do God's will are His family. How can you do God's will?
  • Jesus was sad that people's hearts were hard. How can we keep soft hearts?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Mark 3 · Grade 3

The Family of God

Name Date

Read the Story

On the Sabbath, a man with a withered hand was in the synagogue. Some leaders watched to see if Jesus would heal him. Jesus was sad that their hearts were so hard. He told the man, "Stretch out your hand," and it was healed. Then the leaders began to plan how to get rid of Jesus.

Huge crowds came from many places. Jesus healed many people. Then He went up a mountain and chose twelve men, called apostles, to be with Him and to preach. Among them were Simon, whom He named Peter, and James and John.

Some teachers said Jesus' power came from Satan. Jesus said that if a house is divided against itself, it cannot stand. Later His mother and brothers came looking for Him. Jesus said, "whoever does the will of God is my brother, my sister, and mother."

Memory Verse

For whoever does the will of God is my brother, my sister, and mother.”

Mark 3:35 (WEB)

Answer the Questions

  1. What did Jesus do on the Sabbath?

  2. Why was Jesus sad?

  3. Why did Jesus choose the twelve apostles?

  4. What did Jesus say about a divided house?

  5. Who did Jesus say is His family?

Put the Story in Order

Write what happened in each box.

1
2
3
4
5

Prayer

Dear God, thank You for this Bible story. Help me to . Amen.

Take It Home

For families: talk about these together.

  • Jesus said people who do God's will are His family. How can you do God's will?
  • Some close to Jesus thought He was out of His mind. How can you keep following Jesus when people close to you do not understand?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Mark 3 · Grade 4

With Him and Sent Out

Name Date

Read and Think

Jesus entered the synagogue where there was a man with a withered hand. The Pharisees watched to accuse Him if He healed on the Sabbath. Jesus asked, "Is it lawful on the Sabbath day to do good or to do harm?" They were silent. Grieved at the hardness of their hearts, Jesus healed the man. The Pharisees went out and plotted with the Herodians how to destroy Him.

Great crowds came from Galilee, Judea, Jerusalem and beyond. Jesus healed many, and even unclean spirits recognized Him as the Son of God. Then He went up the mountain and appointed twelve, "that they might be with him, and that he might send them out to preach."

Jesus' family thought He was out of His mind, and scribes from Jerusalem claimed He cast out demons by Beelzebul. Jesus answered with parables: a kingdom or house divided cannot stand; no one can plunder a strong man's house without first binding him. Jesus warned against calling the Holy Spirit's work evil. When His family came, He looked at those around Him and said that whoever does God's will is His brother, sister and mother.

Show What You Know

  1. What question did Jesus ask before healing on the Sabbath?

  2. What two purposes did Jesus have for appointing the twelve?

  3. What did the scribes accuse Jesus of?

  4. Whom did Jesus call His true family?

Word Bank Fill-In

Use the word bank to fill in each blank.

handSabbathGod
  1. Jesus entered the synagogue where there was a man with a withered .
  2. The Pharisees watched to accuse Him if He healed on the .
  3. Jesus healed many, and even unclean spirits recognized Him as the Son of .

Think About It

  1. Jesus called the twelve first to be with him. Why is being with Jesus important before serving Him?

  2. How does belonging to God's family change the way you treat other believers?

Memory Verse

“He appointed twelve, that they might be with him, and that he might send them out to preach”

Mark 3:14 (WEB)

Copy It

Prayer

Dear God, thank You for this Bible story. Help me to . Amen.

Take It Home

For families: talk about these together.

  • How can you spend time with Jesus before you serve?
  • What does it mean to be part of Jesus' family?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Mark 3 · Grade 5

Binding the Strong Man

Name Date

Read and Think

Mark 3 sharpens the conflict. In the synagogue, Jesus turned the Sabbath question into a moral one: is it right to do good or harm, to save life or kill? The leaders' silence revealed hardened hearts, and their plot with the Herodians, normally their political rivals, shows how far they would go. Ironically, they planned harm on the Sabbath while Jesus did good.

Jesus' popularity spread far beyond Galilee. On a mountain, echoing Moses at Sinai, Jesus appointed twelve apostles, a new Israel built around Himself, like the twelve tribes. Their calling was relational first, being with Him, then missional, preaching and having authority over demons.

When scribes accused Him of working by Beelzebul, Jesus exposed the absurdity: Satan would not fight himself. The parable of the strong man shows Jesus has come to bind Satan and rescue his captives. The warning about blasphemy against the Holy Spirit concerns those who knowingly call God's saving work evil and refuse it. Jesus then defined His true family not by blood but by obedience to God's will.

Show What You Know

  1. How did Jesus turn the Sabbath debate into a moral question?

  2. What is ironic about the leaders' plotting on the Sabbath?

  3. What does the choosing of twelve on a mountain suggest?

  4. What does the parable of the strong man teach?

  5. How did Jesus define His true family?

Crossword

214365

Across

  1. Jesus had one ready so the crowd would not press on Him.
  2. How many apostles Jesus chose.
  3. Jesus healed a man on this day.

Down

  1. Whoever does God's will is Jesus' ____.
  2. The apostles would go out to ____.
  3. Jesus told the man to stretch it out.

Think About It

  1. Why do you think the leaders could see Jesus' miracles and still reject Him?

  2. What does it mean for you to be part of Jesus' family?

Memory Verse

“But no one can enter into the house of the strong man to plunder unless he first binds the strong man; then he will plunder his house.”

Mark 3:27 (WEB)

Copy It

Prayer

Dear God, thank You for this Bible story. Help me to . Amen.

Take It Home

For families: talk about these together.

  • Jesus called His followers to be with Him first. How can you spend time with Jesus before you serve Him?
  • How can you treat other Christians like family?
  • What is one specific way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.