The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 3

Prints on letter paper in black and white. No answers are printed on the student sheet.

Mark 3 · Grade 2

Twelve Friends

Name Date

Read the Story

One day Jesus saw a man with a hand that did not work. Jesus said, "Stretch out your hand." The man did, and his hand was made well!

So many people came to Jesus that He had a boat ready, so the crowd would not press on Him.

Jesus went up a mountain. He chose twelve men to be His apostles. They would be with Jesus. Then He would send them out to preach.

Memory Verse

“He appointed twelve, that they might be with him, and that he might send them out to preach”

Mark 3:14 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What was wrong with the man's hand?

    It did not workTwelveStretch out your hand

  2. What did Jesus tell the man?

    It did not workStretch out your handTwelve

  3. Why did Jesus have a boat ready?

  4. How many apostles did Jesus choose?

    TwelveIt did not workStretch out your hand

  5. What would the apostles do?

Word Search

Find and circle each word. Words go across and down.

PREACHCKWGVJMRLAUCVNNEDLRNSAPPOINTEDBNTWELVEMOFSABBATHADYFAMILYTFRIENDSSMMMGHPFKY
  • APPOINTED
  • FRIENDS
  • SABBATH
  • TWELVE
  • FAMILY
  • PREACH
  • HAND
  • BOAT

Prayer

Dear God, thank You for this Bible story. Help me to . Amen.

Take It Home

For families: talk about these together.

  • Jesus said people who do God's will are His family. How can you do God's will?
  • Jesus was sad that people's hearts were hard. How can we keep soft hearts?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.