The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 12

For teachers and parents. Prints separately from the student sheets.

Leviticus 12 · For teachers and parents

Answer Key: After a Baby Is Born

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolA Baby Is a Gift

babyfamilylambdovetabernacle

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenA New Baby

BABY → picture 2DOVE → picture 4LAMB → picture 1FAMILY → picture 3

Grade 1Thank God for Babies

God gives babies. → picture 2A poor family could bring two doves. → picture 4Some brought a lamb. → picture 5The mom came to the tent. → picture 1Mary and Joseph obeyed this rule. → picture 3

Order:

1. A baby is born2. Mother rests and waits3. She brings a lamb4. She is clean again

Grade 2Mary and Joseph Obey

  1. What did the mom do after the baby was born? She rested and waited for some days.
  2. What happened on the eighth day? A baby boy was given God's special sign.
  3. What could a poor mom bring? Two doves (circle)
  4. Who obeyed this rule when Jesus was born? Mary and Joseph (circle)
  5. What does it tell us about Jesus' family? They were poor. (circle)
HOCLYOUNGOFFERCFMDFAHGPHLPAPEHLNIAIDRMIWGLMGRVOPGODBEAHJYYHMCOMFKSONTANDSGGGJDHNW

Grade 3A Lamb or Two Birds

  1. What is a time of purification? A time of waiting before she could go to the sanctuary
  2. What happened on the eighth day for a baby boy? He was circumcised as a sign of God's covenant.
  3. What did the mother bring if she could afford it? A lamb and a young pigeon or a dove
  4. What could a poor mother bring? Two turtledoves or two young pigeons
  5. Who brought this offering after Jesus was born? Mary
1: A baby is born2: Mother rests and waits3: She brings a lamb4: She is clean again
VDCRYLAMBTRPHYAYKRUUKIIOSONUGALGLUPNFHPFVEDNBTOFFEROTGVNAJCPMNOFEIGHTHAFKGWOMANHL

Grade 4A Humble Offering

  1. Was having a baby a sin? No; children are a blessing from God.
  2. What happened on the eighth day? A baby boy was circumcised, the sign of God's covenant with Abraham.
  3. What offering did a poor mother bring? Two turtledoves or two young pigeons
  4. What does Mary's offering tell us about her family? They were a poor, humble family.

Word bank: 1. God; 2. eighth; 3. lamb; 4. young; 5. Son

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The Offering of the Poor

  1. Was the mother's uncleanness about wrongdoing? No, it was about the ceremonial purity of worship.
  2. What was the covenant sign given on the eighth day? Circumcision, the sign given to Abraham
  3. What kind provision did God make for the poor? They could bring two turtledoves or two young pigeons instead of a lamb.
  4. What happened to Jesus on the eighth day? He was circumcised and named Jesus.
  5. What does Second Corinthians 8 say about Jesus? Though He was rich, He became poor for our sakes.
4MOTHERARY5BAB3LAM1EIGHH2DOVS

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.