The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 12

Every grade prints starting on a new page. No answers are included.

Leviticus 12 · Preschool

A Baby Is a Gift

Name Date

Color the baby and the doves! A new baby is a gift from God.

Can you find these in the picture? Circle each one!

Bible Verse

If she cannot afford a lamb, then she shall take two turtledoves or two young pigeons: the one for a burnt offering, and the other for a sin offering. The priest shall make atonement for her, and she shall be clean.’”

Leviticus 12:8 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: When Jesus was a baby, Mary and Joseph brought two birds to God, just like this verse says.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Leviticus 12 · Kindergarten

A New Baby

Name Date

Trace the Words

Trace each word with your pencil.

BABY
MOM
DOVE
LAMB
In the eighth day the flesh of his foreskin shall be circumcised.

Leviticus 12:3 (WEB)

Match the Pictures

Draw a line from each word to its picture.

BABY
DOVE
LAMB
FAMILY

Mini Maze

Help find the way through the maze.

Draw It

Draw a baby you know.

Prayer

Dear God, thank You for babies and families. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who takes care of babies?
  • How was Jesus a baby like you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Leviticus 12 · Grade 1

Thank God for Babies

Name Date

Trace the Words

Trace the words and the verse.

BABY
EIGHTH
DOVES
GIFT
In the eighth day the flesh of his foreskin shall be circumcised.

Leviticus 12:3 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

God gives babies.
A poor family could bring two doves.
Some brought a lamb.
The mom came to the tent.
Mary and Joseph obeyed this rule.

After a Baby Is Born

Write the number 1 to 4 in each circle to show the right order.

Mother rests and waits

She is clean again

A baby is born

She brings a lamb

Draw a baby you know.

Memory Verse

“In the eighth day the flesh of his foreskin shall be circumcised.”

Leviticus 12:3 (WEB)

Prayer

Dear God, thank You for babies and families. Help me . Amen.

Take It Home

For families: talk about these together.

  • What could a poor mother bring?
  • How can you help a new baby's family?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Leviticus 12 · Grade 2

Mary and Joseph Obey

Name Date

Read the Story

God gave rules for a mom after a new baby was born. She rested and waited for some days.

On the eighth day, a baby boy was given God's special sign. Later the mom brought a lamb and a bird to God. If she was poor, she could bring two doves.

When Jesus was born, Mary and Joseph obeyed this rule. They brought two birds to God. That means they were poor. God's own Son came to a poor family.

Memory Verse

If she cannot afford a lamb, then she shall take two turtledoves or two young pigeons: the one for a burnt offering, and the other for a sin offering. The priest shall make atonement for her, and she shall be clean.’”

Leviticus 12:8 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did the mom do after the baby was born?

  2. What happened on the eighth day?

  3. What could a poor mom bring?

    They were poorTwo dovesMary and Joseph

  4. Who obeyed this rule when Jesus was born?

    Two dovesThey were poorMary and Joseph

  5. What does it tell us about Jesus' family?

    They were poorTwo dovesMary and Joseph

Word Search

Find and circle each word. Words go across and down.

HOCLYOUNGOFFERCFMDFAHGPHLPAPEHLNIAIDRMIWGLMGRVOPGODBEAHJYYHMCOMFKSONTANDSGGGJDHNW
  • PIGEON
  • EIGHTH
  • CHILD
  • WOMAN
  • YOUNG
  • OFFER
  • LAMB
  • SON

Prayer

Dear God, thank You for babies and families. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you help a family with a new baby?
  • How can your family thank God for each other?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Leviticus 12 · Grade 3

A Lamb or Two Birds

Name Date

Read the Story

God told Moses about the time after a mother gives birth. She had days of purification. This was a time of waiting before she could go to the sanctuary. On the eighth day, a baby boy was circumcised. It was a sign of God's covenant.

When the days were done, the mother came to the door of the Tent of Meeting. She brought a lamb and a young pigeon or a dove. The priest made atonement for her, and she was clean.

If she could not afford a lamb, she could bring two turtledoves or two young pigeons. Luke tells us that Mary brought this gift after Jesus was born. The Savior grew up in a poor family that trusted God.

Memory Verse

If she cannot afford a lamb, then she shall take two turtledoves or two young pigeons: the one for a burnt offering, and the other for a sin offering. The priest shall make atonement for her, and she shall be clean.’”

Leviticus 12:8 (WEB)

Answer the Questions

  1. What is a time of purification?

  2. What happened on the eighth day for a baby boy?

  3. What did the mother bring if she could afford it?

  4. What could a poor mother bring?

  5. Who brought this offering after Jesus was born?

After a Baby Is Born

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

VDCRYLAMBTRPHYAYKRUUKIIOSONUGALGLUPNFHPFVEDNBTOFFEROTGVNAJCPMNOFEIGHTHAFKGWOMANHL
  • PIGEON
  • EIGHTH
  • CHILD
  • WOMAN
  • YOUNG
  • OFFER
  • LAMB
  • SON

Prayer

Dear God, thank You for babies and families. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you welcome a new baby and thank God?
  • What could a family give if they had little money?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Leviticus 12 · Grade 4

A Humble Offering

Name Date

Read and Think

Leviticus 12 gives the law for a mother after a baby is born. Having a baby was not a sin. Children are a blessing from God. But the mother had a time of waiting and cleansing before she could enter the sanctuary. A baby boy was circumcised on the eighth day. This was the sign of God's covenant with Abraham.

When her days were done, the mother brought a lamb and a bird to the priest. If she cannot afford a lamb, then she shall take two turtledoves or two young pigeons. The priest made atonement for her, and she was clean.

In Luke 2, Mary and Joseph brought two birds to the temple. They gave the offering of a poor family. The Son of God was born into a humble home. His parents carefully obeyed God's law.

Show What You Know

  1. Was having a baby a sin?

  2. What happened on the eighth day?

  3. What offering did a poor mother bring?

  4. What does Mary's offering tell us about her family?

Word Bank Fill-In

Use the word bank to fill in each blank.

SonlambGodyoungeighth
  1. Children are a blessing from .
  2. A baby boy was circumcised on the day.
  3. When her days were done, the mother brought a and a bird to the priest.
  4. If she cannot afford a lamb, then she shall take two turtledoves or two pigeons.
  5. The of God was born into a humble home.

Think About It

  1. What does it teach you that Jesus was born into a poor family?

  2. How can your family thank God for the gift of children?

Memory Verse

If she cannot afford a lamb, then she shall take two turtledoves or two young pigeons: the one for a burnt offering, and the other for a sin offering. The priest shall make atonement for her, and she shall be clean.’”

Leviticus 12:8 (WEB)

Copy It

Prayer

Dear God, thank You for babies and families. Help me . Amen.

Take It Home

For families: talk about these together.

  • How could you show care to a mom with a new baby this week?
  • How did Jesus become poor for our sakes?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Leviticus 12 · Grade 5

The Offering of the Poor

Name Date

Read and Think

Leviticus 12 is a short chapter about a mother after the birth of a child. She had a period of ritual uncleanness, followed by days of purification, before she could touch holy things or enter the sanctuary. This was about the ceremonial purity of worship, not about any wrongdoing; Scripture calls children a heritage from the Lord. On the eighth day, a son was circumcised, the covenant sign given to Abraham.

When the days of purification were completed, for a son or for a daughter, she brought to the priest a year old lamb for a burnt offering and a young pigeon or a turtledove for a sin offering. The priest offered them before Yahweh and made atonement for her. God made a kind provision: if she cannot afford a lamb, then she shall take two turtledoves or two young pigeons.

Luke 2 shows how this ancient law touched the life of Jesus. On the eighth day He was circumcised and named Jesus. Later Mary and Joseph brought Him to the temple and offered a pair of turtledoves, or two young pigeons. They brought the offering of the poor. Jesus, the true Lamb of God, came into a family that could not afford a lamb. Second Corinthians 8 says that though He was rich, He became poor for our sakes.

Show What You Know

  1. Was the mother's uncleanness about wrongdoing?

  2. What was the covenant sign given on the eighth day?

  3. What kind provision did God make for the poor?

  4. What happened to Jesus on the eighth day?

  5. What does Second Corinthians 8 say about Jesus?

Crossword

45312

Across

  1. She waited a time of purification.
  2. A new ____ was a gift from God.

Down

  1. A baby boy was circumcised on the ____ day.
  2. Two of these if she could not afford a lamb.
  3. The usual offering.
  4. Jesus' mother brought two birds (Luke 2).

Think About It

  1. Why is it meaningful that Jesus' family could not afford a lamb, when He is the Lamb of God?

  2. How can you thank God for the people who cared for you when you were small?

Memory Verse

“‘When the days of her purification are completed for a son or for a daughter, she shall bring to the priest at the door of the Tent of Meeting, a year old lamb for a burnt offering, and a young pigeon or a turtledove, for a sin offering.

Leviticus 12:6 (WEB)

Copy It

Prayer

Dear God, thank You for babies and families. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does God's rule for poor mothers show about His fairness?
  • How can a church care for families with new babies?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.