The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 12

Prints on letter paper in black and white. No answers are printed on the student sheet.

Leviticus 12 · Grade 2

Mary and Joseph Obey

Name Date

Read the Story

God gave rules for a mom after a new baby was born. She rested and waited for some days.

On the eighth day, a baby boy was given God's special sign. Later the mom brought a lamb and a bird to God. If she was poor, she could bring two doves.

When Jesus was born, Mary and Joseph obeyed this rule. They brought two birds to God. That means they were poor. God's own Son came to a poor family.

Memory Verse

If she cannot afford a lamb, then she shall take two turtledoves or two young pigeons: the one for a burnt offering, and the other for a sin offering. The priest shall make atonement for her, and she shall be clean.’”

Leviticus 12:8 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did the mom do after the baby was born?

  2. What happened on the eighth day?

  3. What could a poor mom bring?

    They were poorTwo dovesMary and Joseph

  4. Who obeyed this rule when Jesus was born?

    Two dovesThey were poorMary and Joseph

  5. What does it tell us about Jesus' family?

    They were poorTwo dovesMary and Joseph

Word Search

Find and circle each word. Words go across and down.

HOCLYOUNGOFFERCFMDFAHGPHLPAPEHLNIAIDRMIWGLMGRVOPGODBEAHJYYHMCOMFKSONTANDSGGGJDHNW
  • PIGEON
  • EIGHTH
  • CHILD
  • WOMAN
  • YOUNG
  • OFFER
  • LAMB
  • SON

Prayer

Dear God, thank You for babies and families. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you help a family with a new baby?
  • How can your family thank God for each other?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.