The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 4

For teachers and parents. Prints separately from the student sheets.

John 4 · For teachers and parents

Answer Key: Living Water

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolJesus at the Well

lj and welllj and personlj and waterlj and jar

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenLiving Water

WELL → picture 3JAR → picture 1WATER → picture 4FIELD → picture 2

Grade 1Living Water

Jesus rests at a well → picture 3Living water → picture 4She leaves her jar → picture 1Fields ready for harvest → picture 5An official's son is healed → picture 2

Order:

1. Jesus rests at a well2. Living water3. She leaves her jar4. Fields ready for harvest5. An official's son is healed

Grade 2The Woman at the Well

  1. Why did Jesus sit by the well? He was tired from walking.
  2. What did Jesus ask the woman for? A drink (circle)
  3. What kind of water did Jesus offer? Living water (circle)
  4. What did the woman leave behind? Her water jar (circle)
  5. What did many people from her town do? They came and believed in Jesus.
RFPDRINKLUMDBWGKBIKWBJARDPVOROEPWFWICWERLMKENTALKSIDLGRTTIYHELBJECAFUIVGIRAIJETPE

Grade 3Never Thirsty Again

  1. Why was the woman surprised that Jesus asked for a drink? Jews did not usually talk to Samaritans.
  2. What does the water Jesus gives become? A spring of water welling up to eternal life
  3. How did Jesus say true worshipers worship the Father? In spirit and truth
  4. What did the Samaritans say about Jesus? He is truly the Savior of the world.
  5. When was the official's son healed? At that very hour Jesus spoke
1: Jesus rests at a well2: Living water3: She leaves her jar4: Fields ready for harvest5: An official's son is healed

Grade 4The Savior of the World

  1. What three customs did Jesus break by talking with the woman? He spoke with a woman, spoke with a Samaritan, and asked to drink from her jar.
  2. What did Jesus say about where to worship? The place does not matter most; worship the Father in spirit and truth.
  3. What did Jesus say His food was? Doing His Father's will
  4. How did Jesus heal the official's son? From far away, just by speaking

Word bank: 1. water; 2. jar; 3. living; 4. well; 5. worship

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Worship in Spirit and Truth

  1. What did Jesus ask the woman for at the well? A drink
  2. Why did Jesus ask the woman about her husband? Not to shame her, but to show He knew her and still offered grace.
  3. What does God seek, according to Jesus? True worshipers who worship in spirit and truth
  4. How did the woman change after meeting Jesus? She left her water jar and called her whole town to come and see Jesus.
  5. How did the official show faith? He believed the word Jesus spoke and went home before seeing the healing.
5SAVIOR3LIVNG4JR1SAMAITAN2WEL6DRIK

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.