The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 4

Prints on letter paper in black and white. No answers are printed on the student sheet.

John 4 · Grade 2

The Woman at the Well

Name Date

Read the Story

Jesus was tired from walking. He sat by a well. A woman came to get water. Jesus asked her for a drink.

Jesus said, I can give you living water. If you drink it, you will never be thirsty again. Jesus was talking about the new life He gives.

Jesus knew all about the woman. He told her He was the Savior God promised. She left her water jar and ran to tell her town. Many people came and believed in Jesus.

Memory Verse

but whoever drinks of the water that I will give him will never thirst again; but the water that I will give him will become in him a well of water springing up to eternal life.”

John 4:14 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Why did Jesus sit by the well?

  2. What did Jesus ask the woman for?

    Her water jarLiving waterA drink

  3. What kind of water did Jesus offer?

    Living waterHer water jarHe was tired from walking

  4. What did the woman leave behind?

    A drinkHe was tired from walkingHer water jar

  5. What did many people from her town do?

Word Search

Find and circle each word. Words go across and down.

RFPDRINKLUMDBWGKBIKWBJARDPVOROEPWFWICWERLMKENTALKSIDLGRTTIYHELBJECAFUIVGIRAIJETPE
  • WORSHIP
  • BELIEVE
  • LIVING
  • WATER
  • DRINK
  • WELL
  • LIFE
  • JAR

Prayer

Dear God, thank You for this Bible story. Help me to . Amen.

Take It Home

For families: talk about these together.

  • Why was the woman surprised that Jesus spoke to her?
  • How can you help a friend learn about Jesus?
  • Jesus talked with a woman others ignored. Who can you be kind to who feels left out?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.