The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 8

Prints on letter paper in black and white. No answers are printed on the student sheet.

Job 8 · Grade 2

Bildad's Words

Name Date

Read the Story

Bildad was Job's second friend. He talked next. He asked if God is ever unfair. God is always fair, and that is true.

Bildad told Job to seek God. He said that if Job were pure, God would help him. Bildad thought Job had done wrong. But Job had not done wrong to make this happen.

Bildad said tall plants need water to grow. He said God will not throw away a blameless man. At the end of the book, God said the friends did not speak what was right.

Memory Verse

“If you want to seek God diligently, make your supplication to the Almighty.”

Job 8:5 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who was Job's second friend?

    WaterBildadSeek God

  2. What did Bildad tell Job to do?

    Seek GodBildadWater

  3. What did Bildad think about Job?

  4. What do tall plants need to grow?

    WaterSeek GodBildad

  5. What did God say about the friends at the end?

Word Search

Find and circle each word. Words go across and down.

BLHHHOUSERIAWATERKOYLULYSMSCEFDGGMCPKTLAAHHMIMRFPPDTGDNNDRUTDEEPAPYRUSHRFJUSTICEP
  • LAUGHTER
  • JUSTICE
  • PAPYRUS
  • BILDAD
  • SPIDER
  • WATER
  • HOUSE
  • ROCK

Prayer

Dear God, thank You for being fair and good. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you say kind things to a sad friend?
  • How can you tell if advice is good?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.