The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 8

For teachers and parents. Prints separately from the student sheets.

Job 8 · For teachers and parents

Answer Key: Bildad Speaks

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolPlants Need Water

persontreerockhousemountain

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenPlants Need Water

PLANT → picture 2WATER → picture 4TREE → picture 1FLOWER → picture 3

Grade 1Bildad Talks

Bildad talked to Job. → picture 2He said to seek God. → picture 4Rushes need water to grow. → picture 5Some plants dry up fast. → picture 1God knows Job's heart. → picture 3

Order:

1. Does God pervert justice2. Please inquire of past generations3. Can the papyrus grow up without mire4. He will still fill your mouth with laughter

Grade 2Bildad's Words

  1. Who was Job's second friend? Bildad (circle)
  2. What did Bildad tell Job to do? Seek God (circle)
  3. What did Bildad think about Job? He thought Job had done wrong.
  4. What do tall plants need to grow? Water (circle)
  5. What did God say about the friends at the end? They did not speak what was right.
BLHHHOUSERIAWATERKOYLULYSMSCEFDGGMCPKTLAAHHMIMRFPPDTGDNNDRUTDEEPAPYRUSHRFJUSTICEP

Grade 3Can the Papyrus Grow?

  1. What did Bildad say Job's words were like? A mighty wind
  2. What question did Bildad ask about God? Does God pervert justice?
  3. What did Bildad say God would do if Job were pure? Awaken for him
  4. Who did Bildad tell Job to ask? The people of past generations
  5. What happens to papyrus without water? It withers.
1: Does God pervert justice2: Please inquire of past generations3: Can the papyrus grow up without mire4: He will still fill your mouth with laughter
SPAPYRUSWONROCKLTFMWIDHSASJEPRDSNUWUBILDADGASFYIMSMHTTGPFABUTEISPIDERERCHOUSEWRNE

Grade 4Bildad and the Withering Plant

  1. What was Bildad right about? That God is just
  2. What cruel and mistaken claim did Bildad make? That Job's children had sinned and been given over to their disobedience
  3. What did Bildad say would happen if Job were pure and upright? God would restore him, and his latter end would greatly increase.
  4. What did Bildad compare to papyrus without mire? The paths of all who forget God

Word bank: 1. Bildad; 2. God; 3. Papyrus

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Does God Pervert Justice?

  1. What is Bildad's central question? Does God pervert justice? Or does the Almighty pervert righteousness?
  2. What harsh conclusion does Bildad draw about Job's children? That they sinned and God delivered them into the hand of their disobedience
  3. What is ironic about Bildad's promise that Job's latter end would increase? Job's latter end will increase, but not because Bildad's diagnosis was right.
  4. What does Bildad compare the hope of the godless to? A spider's web
  5. What does God say about the friends in Job 42:7? They have not spoken of Him the thing that is right.
4LAUGHTER2PAPYUS1BILDD3JUSICE5WATR

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.