The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 38

For teachers and parents. Prints separately from the student sheets.

Job 38 · For teachers and parents

Answer Key: Yahweh Answers Job out of the Whirlwind

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Made the Earth

starsseabirdcloudmountain

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenEarth

EARTH → picture 4SEA → picture 3RAIN → picture 2STARS → picture 1

Grade 1God Made It All

God spoke from a storm wind. → picture 3God made the earth. → picture 5God made the sea. → picture 2God made the stars. → picture 4God feeds the raven. → picture 1

Order:

1. Yahweh answered Job out of the whirlwind2. Where were you when I laid the foundations of the earth3. Can you bind the cluster of the Pleiades4. Who provides for the raven his prey

Grade 2Where Were You?

  1. Where did God speak from? A big storm wind called a whirlwind
  2. Was Job there when God made the earth? Job was not there. Only God was there.
  3. What did God ask about? The sea, the snow, the rain, and the stars
  4. Who feeds the baby birds? God
JKDYIWOBESNOWBUYSPRESRTNNEDAATJAVMAEIRHVNVNAWNTKNTWEVFWHIRLWINDRKPVSTARSOLTTUOYUE

Grade 3Out of the Whirlwind

  1. How did Yahweh answer Job? Out of the whirlwind
  2. What did God ask first? Who is this who darkens counsel by words without knowledge?
  3. What did God ask about the earth? Where were you when I laid the foundations of the earth?
  4. Who provides for the raven? God made all these things and cares for them.
1: Yahweh answered Job out of the whirlwind2: Where were you when I laid the foundations of the earth3: Can you bind the cluster of the Pleiades4: Who provides for the raven his prey
WIRAINLEEHHKGPGWDCIMJEARTHPRGSRCSYJJLJFTATNSPWRSEAVOOTIDEWNREMWNYJYESSNDDMRNNPMBB

Grade 4Where Were You?

  1. What did Yahweh tell Job to do? Brace yourself like a man, for I will question you.
  2. What did God ask about the earth? Where were you when I laid the foundations of the earth?
  3. What did God ask about the stars? Can you bind the cluster of the Pleiades, or loosen the cords of Orion?
  4. What did God show Job? He rules all things with wisdom and care.

Word bank: 1. whirlwind; 2. God; 3. earth; 4. sea; 5. snow

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The Lord Speaks

  1. Who finally speaks? Yahweh Himself, out of the whirlwind
  2. How does God describe creation? Like a builder laying a cornerstone while the morning stars sang together
  3. What does God ask about rain? Does the rain have a father?
  4. What does God not tell Job? About the scene in heaven from chapter 1
  5. Whose word is final? God's word
3EARTH2WHILWIN5D4ORON1RAVNEW

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.