The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 31

For teachers and parents. Prints separately from the student sheets.

Job 31 · For teachers and parents

Answer Key: Job's Final Defense

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolHe Sees My Ways

personPathEyesheep

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenShare

DOOR → picture 4FOOD → picture 3STEPS → picture 1KIND → picture 2

Grade 1Job Was Kind

Job shared his food. → picture 5He gave warm wool to the poor. → picture 1He opened his door to travelers. → picture 4Gold was not his hope. → picture 2God sees all our steps. → picture 3

Order:

1. Doesn't he see my ways, and count all my steps2. If I have withheld the poor from their desire3. warmed with my sheep's fleece4. I have opened my doors to the traveler

Grade 2God Sees My Steps

  1. What does God count? All of Job's steps (circle)
  2. Who did Job share his food with? Children who had no father
  3. What did Job give to poor people? Warm wool (circle)
  4. What was not Job's hope? Gold (circle)
  5. Who did Job open his door to? Travelers (circle)
IWHWVLMNKSTSKATNCVWTRHAYPEGFDEAEVSPBWLOPVEDSPKIEOSEPVOMVDERRLGOCUTOCSGERBGNBWENKR

Grade 3Weighed in an Even Balance

  1. What does God count? All my steps
  2. What did Job ask God to weigh him in? An even balance
  3. What were poor people warmed with? Job's sheep's fleece
  4. Who did Job open his doors to? The traveler
  5. What did Job ask the Almighty to do? Answer me
1: Doesn't he see my ways, and count all my steps2: If I have withheld the poor from their desire3: warmed with my sheep's fleece4: I have opened my doors to the traveler
POORCWEPGJLCKYFTUSRWIDOWKITAJKDOORSEBMVASHEEPWAYSJFRASDYKFLEECETRAVELERDCJLJYEFSP

Grade 4A Life Laid Open

  1. What covenant did Job make? A covenant with his eyes to keep his heart pure
  2. Why did Job treat his servants fairly? The same God made both him and them in the womb.
  3. What had Job not made his hope? Gold
  4. How did Job end his defense? Behold, here is my signature! Let the Almighty answer me!

Word bank: 1. God; 2. poor; 3. doors

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Here Is My Signature

  1. What is Job's final defense like? A solemn oath in a court of law
  2. Why does Job ask to be weighed in an even balance? That God may know his integrity
  3. Why does Job say trusting gold would be iniquity? I would have denied the God who is above.
  4. What does Job do at the end of his defense? He signs it and asks the Almighty to answer him.
  5. How will God answer Job? In chapters 38 to 41, though not in the way Job expects
2WAY3STEPS1TRVELER4FLEC5DOOS

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.