The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 31

Every grade prints starting on a new page. No answers are included.

Job 31 · Preschool

He Sees My Ways

Name Date

Color the open door! Job opened his door to travelers.

Can you find these in the picture? Circle each one!

Bible Verse

“Doesn’t he see my ways, and count all my steps?”

Job 31:4 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God sees everything we do. Job shared his food and opened his door to people who needed a place to stay.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 31 · Kindergarten

Share

Name Date

Trace the Words

Trace each word with your pencil.

SHARE
DOOR
FOOD
STEPS
Doesn’t he see my ways, and count all my steps?

Job 31:4 (WEB)

Match the Pictures

Draw a line from each word to its picture.

DOOR
FOOD
STEPS
KIND

Mini Maze

Help find the way through the maze.

Draw It

Draw yourself opening your door to someone.

Prayer

Dear God, thank You for seeing every step I take. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does God see?
  • How can you share with others?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 31 · Grade 1

Job Was Kind

Name Date

Trace the Words

Trace the words and the verse.

SHARE
DOOR
WAYS
STEPS
Doesn’t he see my ways, and count all my steps?

Job 31:4 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Job shared his food.
He gave warm wool to the poor.
He opened his door to travelers.
Gold was not his hope.
God sees all our steps.

God Counts My Steps

Write the number 1 to 4 in each circle to show the right order.

Doesn't he see my ways, and count all my steps

warmed with my sheep's fleece

If I have withheld the poor from their desire

I have opened my doors to the traveler

Draw yourself opening your door to someone.

Memory Verse

“Doesn’t he see my ways, and count all my steps?”

Job 31:4 (WEB)

Prayer

Dear God, thank You for seeing every step I take. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did Job share with the fatherless?
  • Who did Job open his door to?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 31 · Grade 2

God Sees My Steps

Name Date

Read the Story

Job said God sees all his ways. God counts all his steps.

Job said he shared his food with children who had no father. He gave warm wool to poor people.

Job said gold was not his hope. He opened his door to travelers. Then Job's words were done. He waited for God to answer.

Memory Verse

“Doesn’t he see my ways, and count all my steps?”

Job 31:4 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What does God count?

    Warm woolTravelersAll of Job's steps

  2. Who did Job share his food with?

  3. What did Job give to poor people?

    TravelersAll of Job's stepsWarm wool

  4. What was not Job's hope?

    Children who had no fatherGoldWarm wool

  5. Who did Job open his door to?

    Children who had no fatherAll of Job's stepsTravelers

Word Search

Find and circle each word. Words go across and down.

IWHWVLMNKSTSKATNCVWTRHAYPEGFDEAEVSPBWLOPVEDSPKIEOSEPVOMVDERRLGOCUTOCSGERBGNBWENKR
  • TRAVELER
  • FLEECE
  • STEPS
  • WIDOW
  • SHEEP
  • DOORS
  • WAYS
  • POOR

Prayer

Dear God, thank You for seeing every step I take. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you help a family that does not have enough?
  • How can you welcome a new person?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 31 · Grade 3

Weighed in an Even Balance

Name Date

Read the Story

Job asked, Doesn't he see my ways, and count all my steps? He asked God to weigh him in an even balance, that God may know his integrity.

Job said he had not eaten his morsel alone while the fatherless had none. Poor people were warmed with his sheep's fleece. He had not made gold his hope.

Job said he had not rejoiced when his enemy fell. The foreigner has not camped in the street, but I have opened my doors to the traveler. Job said, Let the Almighty answer me! The words of Job are ended.

Memory Verse

“Doesn’t he see my ways, and count all my steps?”

Job 31:4 (WEB)

Answer the Questions

  1. What does God count?

  2. What did Job ask God to weigh him in?

  3. What were poor people warmed with?

  4. Who did Job open his doors to?

  5. What did Job ask the Almighty to do?

God Counts My Steps

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

POORCWEPGJLCKYFTUSRWIDOWKITAJKDOORSEBMVASHEEPWAYSJFRASDYKFLEECETRAVELERDCJLJYEFSP
  • TRAVELER
  • FLEECE
  • STEPS
  • WIDOW
  • SHEEP
  • DOORS
  • WAYS
  • POOR

Prayer

Dear God, thank You for seeing every step I take. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you trust God more than money?
  • Why did Job treat his servants fairly?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 31 · Grade 4

A Life Laid Open

Name Date

Read and Think

In his final speech, Job laid his whole life open before God. He said he made a covenant with his eyes to keep his heart pure. Doesn't he see my ways, and count all my steps? Let me be weighed in an even balance, that God may know my integrity.

Job listed sins he had not done. He had not withheld the poor from their desire or eaten his morsel alone. He had not seen anyone perish for want of clothing. He had treated his servants fairly, saying, Didn't he who made me in the womb make him? He had not made gold his hope or rejoiced because his wealth was great.

Job had not rejoiced when his enemy fell. He opened his doors to the traveler. Then he signed his defense: Oh that I had one to hear me! Behold, here is my signature! Let the Almighty answer me! The words of Job are ended. Now Job waited for God.

Show What You Know

  1. What covenant did Job make?

  2. Why did Job treat his servants fairly?

  3. What had Job not made his hope?

  4. How did Job end his defense?

Word Bank Fill-In

Use the word bank to fill in each blank.

doorspoorGod
  1. In his final speech, Job laid his whole life open before .
  2. He had not withheld the from their desire or eaten his morsel alone.
  3. He opened his to the traveler.

Think About It

  1. Job treated his servants fairly because God made them too. How should knowing God made everyone change how you treat others?

  2. Job did not rejoice when his enemy fell. How can you respond with kindness when someone who hurt you has trouble?

Memory Verse

“Doesn’t he see my ways, and count all my steps?”

Job 31:4 (WEB)

Copy It

Prayer

Dear God, thank You for seeing every step I take. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you guard what you look at?
  • How can you live so you would be glad for God to check your heart?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 31 · Grade 5

Here Is My Signature

Name Date

Read and Think

Job's final defense is like a solemn oath in a court of law. He begins with the heart: I made a covenant with my eyes, promising to keep his eyes and heart pure. Doesn't he see my ways, and count all my steps? Let me be weighed in an even balance, that God may know my integrity. Job is confident that God's perfect scales would show his innocence.

Job goes through areas of life one by one. If I have withheld the poor from their desire, or have caused the eyes of the widow to fail, or have eaten my morsel alone, and the fatherless has not eaten of it, then let disaster come. He treated his servants justly, because the same God fashioned them in the womb. If I have made gold my hope, this would be an iniquity, for I would have denied the God who is above. He did not rejoice at the destruction of an enemy, and he opened his doors to the traveler.

Job ends, Oh that I had one to hear me! Behold, here is my signature! Let the Almighty answer me! The words of Job are ended. Job has rested his case. He has answered every false charge of the friends. Yet his confidence also edges toward demanding that God explain Himself. In chapters 38 to 41, God will answer Job, though not in the way Job expects.

Show What You Know

  1. What is Job's final defense like?

  2. Why does Job ask to be weighed in an even balance?

  3. Why does Job say trusting gold would be iniquity?

  4. What does Job do at the end of his defense?

  5. How will God answer Job?

Crossword

23145

Across

  1. Doesn't he see my ____
  2. warmed with my sheep's ____
  3. I have opened my ____ to the traveler

Down

  1. I have opened my doors to the ____
  2. Doesn't he see my ways, and count all my ____

Think About It

  1. Job said trusting gold would deny God. What things are people tempted to trust more than God?

  2. Job looked at his whole life before God. What is one area of your life where you want to honor God more?

Memory Verse

“Doesn’t he see my ways, and count all my steps?”

Job 31:4 (WEB)

Copy It

Prayer

Dear God, thank You for seeing every step I take. Help me . Amen.

Take It Home

For families: talk about these together.

  • What do people trust more than God?
  • How should knowing God made everyone change how you treat others?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.