The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 31

Prints on letter paper in black and white. No answers are printed on the student sheet.

Job 31 · Grade 2

God Sees My Steps

Name Date

Read the Story

Job said God sees all his ways. God counts all his steps.

Job said he shared his food with children who had no father. He gave warm wool to poor people.

Job said gold was not his hope. He opened his door to travelers. Then Job's words were done. He waited for God to answer.

Memory Verse

“Doesn’t he see my ways, and count all my steps?”

Job 31:4 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What does God count?

    Warm woolTravelersAll of Job's steps

  2. Who did Job share his food with?

  3. What did Job give to poor people?

    TravelersAll of Job's stepsWarm wool

  4. What was not Job's hope?

    Children who had no fatherGoldWarm wool

  5. Who did Job open his door to?

    Children who had no fatherAll of Job's stepsTravelers

Word Search

Find and circle each word. Words go across and down.

IWHWVLMNKSTSKATNCVWTRHAYPEGFDEAEVSPBWLOPVEDSPKIEOSEPVOMVDERRLGOCUTOCSGERBGNBWENKR
  • TRAVELER
  • FLEECE
  • STEPS
  • WIDOW
  • SHEEP
  • DOORS
  • WAYS
  • POOR

Prayer

Dear God, thank You for seeing every step I take. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you help a family that does not have enough?
  • How can you welcome a new person?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.