The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 18

For teachers and parents. Prints separately from the student sheets.

Job 18 · For teachers and parents

Answer Key: Bildad Speaks Again

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolA Lamp in the Tent

lamptentpersonlighttree

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenA Lamp

LAMP → picture 4TENT → picture 3PATH → picture 2TREE → picture 1

Grade 1Bildad Again

Bildad talked again. → picture 3He talked about a lamp. → picture 5He talked about a dark tent. → picture 2He talked about a trap on a path. → picture 4Bildad was wrong about Job. → picture 1

Order:

1. How long will you hunt for words2. the light of the wicked will be put out3. The light will be dark in his tent4. His lamp above him will be put out

Grade 2Bildad Talks Again

  1. Who talked to Job again? Bildad (circle)
  2. What did Bildad think Job was doing? Treating the friends badly (circle)
  3. What happens to the light of a wicked man? It goes out. (circle)
  4. Where does the lamp go dark? In his tent (circle)
  5. Was Bildad right about Job? No. Bildad was wrong. (circle)
PLUUNJNBGWIPLAMPRPJGYOFWMSGTHGMAIAHNRTNETCRKPAFTFGKRUAPWEWVEWOTRNNVKDYEHCFTWORDSO

Grade 3The Lamp Put Out

  1. What did Bildad ask Job? How long will you hunt for words?
  2. What will happen to the light of the wicked? It will be put out.
  3. What waits for the wicked on the path? A trap
  4. What did Bildad mean about Job? That Job did not know God
  5. What did God later say about the friends? They had not spoken what was right.
1: How long will you hunt for words2: the light of the wicked will be put out3: The light will be dark in his tent4: His lamp above him will be put out
CYGLAMPOYYWICKEDCKEEEBVORJNTWORDSRSETENTCHTLTLPVJAJRITCAIOBAAGKSTUPSWPHYLHTEUSNTU

Grade 4A Picture Painted for Job

  1. What did Bildad ask at the start? How long Job would hunt for words and why he counted the friends as unclean
  2. What happens to the lamp of the wicked in Bildad's speech? It will be dark in his tent.
  3. How did Bildad end his speech? Surely such are the dwellings of the unrighteous. This is the place of him who doesn't know God.
  4. Why was Bildad wrong? Job knew God.

Word bank: 1. words; 2. wicked; 3. lamp; 4. trap; 5. God

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The Dwellings of the Unrighteous

  1. How does Bildad's second speech open? With wounded pride: How long will you hunt for words? Why are we counted as animals?
  2. What does Bildad say about the lamp of the wicked? His lamp above him will be put out, and the light will be dark in his tent.
  3. What does Bildad say happens to the memory of the wicked? It perishes from the earth.
  4. Why does Bildad's description fit Job's losses so closely? He is telling Job that he is the wicked man.
  5. What does God say in Job 42:7? The friends have not spoken of Him what is right, as His servant Job has.
2BI3LDADAMP1WORS

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.