The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 18

Every grade prints starting on a new page. No answers are included.

Job 18 · Preschool

A Lamp in the Tent

Name Date

Color the lamp and the tent! Bildad talked about a lamp.

Can you find these in the picture? Circle each one!

Bible Verse

“The light will be dark in his tent. His lamp above him will be put out.”

Job 18:6 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Bildad talked about a lamp going out. But he was wrong about Job. God is our light, and He never goes out.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 18 · Kindergarten

A Lamp

Name Date

Trace the Words

Trace each word with your pencil.

LAMP
LIGHT
TENT
PATH
The light will be dark in his tent. His lamp above him will be put out.

Job 18:6 (WEB)

Match the Pictures

Draw a line from each word to its picture.

LAMP
TENT
PATH
TREE

Mini Maze

Help find the way through the maze.

Draw It

Draw a lamp shining in a tent.

Prayer

Dear God, thank You for being my light. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does a lamp do?
  • Who is our light?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 18 · Grade 1

Bildad Again

Name Date

Trace the Words

Trace the words and the verse.

LIGHT
LAMP
TENT
PATH
The light will be dark in his tent. His lamp above him will be put out.

Job 18:6 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Bildad talked again.
He talked about a lamp.
He talked about a dark tent.
He talked about a trap on a path.
Bildad was wrong about Job.

Bildad Speaks Again

Write the number 1 to 4 in each circle to show the right order.

His lamp above him will be put out

How long will you hunt for words

the light of the wicked will be put out

The light will be dark in his tent

Draw a lamp shining in a tent.

Memory Verse

“The light will be dark in his tent. His lamp above him will be put out.”

Job 18:6 (WEB)

Prayer

Dear God, thank You for being my light. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did Bildad talk about?
  • Was Bildad right about Job?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 18 · Grade 2

Bildad Talks Again

Name Date

Read the Story

Bildad talked to Job again. He did not like what Job said. He thought Job was treating the friends badly.

Bildad said the light of a wicked man goes out. His lamp goes dark in his tent.

Bildad thought Job was wicked. But Bildad was wrong. God said the friends did not speak what was right.

Memory Verse

“The light will be dark in his tent. His lamp above him will be put out.”

Job 18:6 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who talked to Job again?

    BildadIn his tentIt goes out

  2. What did Bildad think Job was doing?

    It goes outTreating the friends badlyIn his tent

  3. What happens to the light of a wicked man?

    It goes outIn his tentTreating the friends badly

  4. Where does the lamp go dark?

    BildadIn his tentIt goes out

  5. Was Bildad right about Job?

    No. Bildad was wrongIt goes outIn his tent

Word Search

Find and circle each word. Words go across and down.

PLUUNJNBGWIPLAMPRPJGYOFWMSGTHGMAIAHNRTNETCRKPAFTFGKRUAPWEWVEWOTRNNVKDYEHCFTWORDSO
  • WICKED
  • LIGHT
  • WORDS
  • LAMP
  • TENT
  • TRAP
  • PATH
  • NET

Prayer

Dear God, thank You for being my light. Help me . Amen.

Take It Home

For families: talk about these together.

  • How do you feel when someone calls you names?
  • Why should we be kind when a friend has trouble?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 18 · Grade 3

The Lamp Put Out

Name Date

Read the Story

Bildad spoke a second time. He asked Job, How long will you hunt for words? He asked why Job counted the friends as animals.

Bildad said, Yes, the light of the wicked will be put out. The light will be dark in his tent. His lamp above him will be put out. He said a trap waits for the wicked on the path.

Bildad ended, Surely such are the dwellings of the unrighteous. This is the place of him who doesn't know God. Bildad meant that Job did not know God. But Job did know God. God later said the friends had not spoken what was right.

Memory Verse

“Yes, the light of the wicked will be put out. The spark of his fire won’t shine.

Job 18:5 (WEB)

Answer the Questions

  1. What did Bildad ask Job?

  2. What will happen to the light of the wicked?

  3. What waits for the wicked on the path?

  4. What did Bildad mean about Job?

  5. What did God later say about the friends?

Bildad Speaks Again

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

CYGLAMPOYYWICKEDCKEEEBVORJNTWORDSRSETENTCHTLTLPVJAJRITCAIOBAAGKSTUPSWPHYLHTEUSNTU
  • WICKED
  • LIGHT
  • WORDS
  • LAMP
  • TENT
  • TRAP
  • PATH
  • NET

Prayer

Dear God, thank You for being my light. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did Bildad say about the dwellings of the unrighteous?
  • How did Bildad end his speech?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 18 · Grade 4

A Picture Painted for Job

Name Date

Read and Think

Bildad's second speech began with irritation. He asked how long Job would hunt for words and why he counted the friends as unclean animals. He asked whether the earth would be forsaken just for Job.

Bildad then described the fate of the wicked. His light will be put out, and his lamp will be dark in his tent. His own counsel will cast him down, and a trap waits for him on the path. Terrors will chase him, his roots will dry up, and his memory will perish from the earth.

Bildad ended, Surely such are the dwellings of the unrighteous. This is the place of him who doesn't know God. Every detail seemed aimed at Job, who had lost his children and wealth. But Bildad was wrong. Job knew God, and God later said the friends had not spoken what is right.

Show What You Know

  1. What did Bildad ask at the start?

  2. What happens to the lamp of the wicked in Bildad's speech?

  3. How did Bildad end his speech?

  4. Why was Bildad wrong?

Word Bank Fill-In

Use the word bank to fill in each blank.

trapwordswickedGodlamp
  1. He asked how long Job would hunt for and why he counted the friends as unclean animals.
  2. Bildad then described the fate of the .
  3. His light will be put out, and his will be dark in his tent.
  4. His own counsel will cast him down, and a waits for him on the path.
  5. Job knew , and God later said the friends had not spoken what is right.

Think About It

  1. Bildad painted a picture of the wicked to describe Job. How can we avoid judging people by their troubles?

  2. God's light never goes out for those who know Him. How does God light your way?

Memory Verse

Surely such are the dwellings of the unrighteous. This is the place of him who doesn’t know God.”

Job 18:21 (WEB)

Copy It

Prayer

Dear God, thank You for being my light. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you stay calm when someone's words bother you?
  • How can you stay kind to someone who sees you wrongly?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 18 · Grade 5

The Dwellings of the Unrighteous

Name Date

Read and Think

Bildad's second speech opens with wounded pride. How long will you hunt for words? Why are we counted as animals, which have become unclean in your sight? You who tear yourself in your anger, will the earth be forsaken for you? Bildad cannot accept that the moral order he believes in might not explain Job's case.

Bildad describes the fate of the wicked in vivid images. Yes, the light of the wicked will be put out. The spark of his fire won't shine. The light will be dark in his tent. His lamp above him will be put out. The steps of his strength will be shortened, and his own counsel will cast him down. Snares, traps, and terrors chase him. His roots dry up, his branch is cut off, and his memory perishes from the earth.

He concludes, Surely such are the dwellings of the unrighteous. This is the place of him who doesn't know God. Bildad's description fits Job's losses closely, and that is the point: he is telling Job that he is the wicked man. But Job is the one who knows God. In Job 42:7, God says the friends have not spoken of Him the thing that is right, as His servant Job has.

Show What You Know

  1. How does Bildad's second speech open?

  2. What does Bildad say about the lamp of the wicked?

  3. What does Bildad say happens to the memory of the wicked?

  4. Why does Bildad's description fit Job's losses so closely?

  5. What does God say in Job 42:7?

Crossword

231

Across

  1. He spoke to Job a second time about the wicked.

Down

  1. How long will you hunt for ____
  2. His ____ above him will be put out.

Think About It

  1. Bildad could not accept that his ideas might not explain Job's pain. How can you stay humble when life does not fit your expectations?

  2. Bildad called Job one who doesn't know God, but he was wrong. How does God's verdict matter more than people's?

Memory Verse

Surely such are the dwellings of the unrighteous. This is the place of him who doesn’t know God.”

Job 18:21 (WEB)

Copy It

Prayer

Dear God, thank You for being my light. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you comfort someone who is grieving?
  • How can we avoid judging people by their troubles?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.