The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 11

For teachers and parents. Prints separately from the student sheets.

Job 11 · For teachers and parents

Answer Key: Zophar Speaks

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Is Very Great

personmountainseasunlight

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenMorning Light

SUN → picture 4SHEEP → picture 3TENT → picture 1FRIEND → picture 2

Grade 1Zophar Talks

Zophar talked to Job. → picture 5God is higher than the sky. → picture 1God is broader than the sea. → picture 4Zophar said darkness would be like morning. → picture 2Zophar said Job would rest in safety. → picture 3

Order:

1. Can you fathom the mystery of God2. They are high as heaven3. broader than the sea4. You will be secure, because there is hope

Grade 2Zophar's Words

  1. Who was Job's third friend? Zophar (circle)
  2. What did Zophar think? He thought Job had done wrong.
  3. What did Zophar say God is higher than? The sky (circle)
  4. What did Zophar tell Job to do? Turn his heart to God
  5. Was Zophar right about Job? No. Zophar was wrong about Job.
HLHEAVENMHTMYSTERYYSYHSMKPPHECJOBVJCFCMGTPRAGEUDEEPERHFRDZOPHAREEKRRESTOGSEAVOREA

Grade 3Can You Fathom God?

  1. What did Zophar say Job did too much? Talked
  2. What did Zophar wish God would do? Speak against Job
  3. What question did Zophar ask? Can you fathom the mystery of God?
  4. What did Zophar say Job should stretch out toward God? His hands
  5. What did Zophar wrongly think? That Job was hiding sin
1: Can you fathom the mystery of God2: They are high as heaven3: broader than the sea4: You will be secure, because there is hope
HHKSVMSESPRMUEKECRHZAYJCAWEEOIVSGUWSAPRYVTWRTVHKIVTEFEEAHOPEPRJNRFYVGDTYABDEEPERL

Grade 4Higher Than Heaven

  1. What harsh claim did Zophar make? That God exacts less than Job's iniquity deserves
  2. What true word did Zophar speak about God? No one can fathom the mystery of God or probe the limits of the Almighty.
  3. What did Zophar urge Job to do? Set his heart aright, stretch out his hands toward God, and put iniquity far away
  4. What false idea did Zophar's promises rest on? That Job was hiding sin

Word bank: 1. Zophar; 2. God; 3. mystery; 4. rest

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The Limits of the Almighty

  1. What does Zophar accuse Job of claiming? My doctrine is pure. I am clean in your eyes.
  2. What cruel claim does Zophar make? That God exacts of Job less than his iniquity deserves
  3. How does Zophar describe the limits of the Almighty? Higher than heaven, deeper than Sheol, longer than the earth, and broader than the sea
  4. What is ironic about Zophar's words on God's mystery? He does not apply the truth to himself, yet claims to know why Job suffers.
  5. What does Zophar promise if Job repents? Life will be clearer than the noonday, and darkness will be as the morning.
4SEA1MYTERY5HOP2HEVEN3ZOPAR

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.