The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 11

Every grade prints starting on a new page. No answers are included.

Job 11 · Preschool

God Is Very Great

Name Date

Color the sun rising in the morning! God is bigger than we can know.

Can you find these in the picture? Circle each one!

Bible Verse

“Can you fathom the mystery of God? Or can you probe the limits of the Almighty?

Job 11:7 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God is so great that we can never know everything about Him. Job's friend Zophar said this, but he was wrong about Job.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 11 · Kindergarten

Morning Light

Name Date

Trace the Words

Trace each word with your pencil.

SUN
HOPE
REST
GOD
Its measure is longer than the earth, and broader than the sea.

Job 11:9 (WEB)

Match the Pictures

Draw a line from each word to its picture.

SUN
SHEEP
TENT
FRIEND

Mini Maze

Help find the way through the maze.

Draw It

Draw something very high or very deep.

Prayer

Dear God, thank You for being bigger than I can understand. Help me . Amen.

Take It Home

For families: talk about these together.

  • How big is God?
  • What makes the morning bright?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 11 · Grade 1

Zophar Talks

Name Date

Trace the Words

Trace the words and the verse.

HIGH
DEEP
HOPE
MORNING
Its measure is longer than the earth, and broader than the sea.

Job 11:9 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Zophar talked to Job.
God is higher than the sky.
God is broader than the sea.
Zophar said darkness would be like morning.
Zophar said Job would rest in safety.

Zophar Speaks

Write the number 1 to 4 in each circle to show the right order.

broader than the sea

Can you fathom the mystery of God

They are high as heaven

You will be secure, because there is hope

Draw something very high or very deep.

Memory Verse

“Its measure is longer than the earth, and broader than the sea.”

Job 11:9 (WEB)

Prayer

Dear God, thank You for being bigger than I can understand. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who talked to Job third?
  • Was Zophar kind to Job?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 11 · Grade 2

Zophar's Words

Name Date

Read the Story

Zophar was Job's third friend. He spoke next. He was not kind to Job. He thought Job had done wrong.

Zophar said God is higher than the sky. He said God is broader than the sea. That is true. God is very great.

Zophar told Job to turn his heart to God. He said there would be hope. But Zophar was wrong about Job. God said the friends did not speak what was right.

Memory Verse

“Can you fathom the mystery of God? Or can you probe the limits of the Almighty?

Job 11:7 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who was Job's third friend?

    The skyZopharTurn his heart to God

  2. What did Zophar think?

  3. What did Zophar say God is higher than?

    ZopharThe skyTurn his heart to God

  4. What did Zophar tell Job to do?

  5. Was Zophar right about Job?

Word Search

Find and circle each word. Words go across and down.

HLHEAVENMHTMYSTERYYSYHSMKPPHECJOBVJCFCMGTPRAGEUDEEPERHFRDZOPHAREEKRRESTOGSEAVOREA
  • MYSTERY
  • ZOPHAR
  • HEAVEN
  • SECURE
  • DEEPER
  • HOPE
  • REST
  • SEA

Prayer

Dear God, thank You for being bigger than I can understand. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you speak kindly to someone who is hurting?
  • How can you speak to a sad friend gently?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 11 · Grade 3

Can You Fathom God?

Name Date

Read the Story

Zophar the Naamathite spoke third. He said Job talked too much. He said Job claimed to be clean. Zophar wished God would speak against Job.

Zophar asked, Can you fathom the mystery of God? He said God's ways are high as heaven and deeper than Sheol. They are longer than the earth and broader than the sea. This is true about God.

Zophar told Job to set his heart aright and stretch out his hands toward God. He said to put iniquity far away. Then life would be clearer than the noonday. But Zophar wrongly thought Job was hiding sin. God later said the friends had not spoken what was right.

Memory Verse

“Can you fathom the mystery of God? Or can you probe the limits of the Almighty?

Job 11:7 (WEB)

Answer the Questions

  1. What did Zophar say Job did too much?

  2. What did Zophar wish God would do?

  3. What question did Zophar ask?

  4. What did Zophar say Job should stretch out toward God?

  5. What did Zophar wrongly think?

Zophar Speaks

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

HHKSVMSESPRMUEKECRHZAYJCAWEEOIVSGUWSAPRYVTWRTVHKIVTEFEEAHOPEPRJNRFYVGDTYABDEEPERL
  • MYSTERY
  • ZOPHAR
  • HEAVEN
  • SECURE
  • DEEPER
  • HOPE
  • REST
  • SEA

Prayer

Dear God, thank You for being bigger than I can understand. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you trust God even when you cannot understand Him?
  • How can you listen before you answer someone?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 11 · Grade 4

Higher Than Heaven

Name Date

Read and Think

Zophar the Naamathite was the harshest of the three friends. He accused Job of mockery and boasting. He even said God exacts less than Job's iniquity deserves. That was not true, because God had called Job blameless.

Yet Zophar spoke a true word about God: Can you fathom the mystery of God? Or can you probe the limits of the Almighty? God's wisdom is high as heaven and deeper than Sheol, longer than the earth, and broader than the sea. Later God Himself will show Job how far His wisdom is beyond man.

Zophar urged Job to set his heart aright, stretch out his hands toward God, and put iniquity far away. He promised that life would be clearer than the noonday and that Job would rest in safety. His promises sound hopeful, but they rested on the false idea that Job was hiding sin. God later said the friends had not spoken what is right.

Show What You Know

  1. What harsh claim did Zophar make?

  2. What true word did Zophar speak about God?

  3. What did Zophar urge Job to do?

  4. What false idea did Zophar's promises rest on?

Word Bank Fill-In

Use the word bank to fill in each blank.

mysteryrestGodZophar
  1. the Naamathite was the harshest of the three friends.
  2. That was not true, because had called Job blameless.
  3. Yet Zophar spoke a true word about God: Can you fathom the of God?
  4. He promised that life would be clearer than the noonday and that Job would in safety.

Think About It

  1. Zophar was harsh with a hurting friend. How can you correct someone gently when it is needed?

  2. God's wisdom is higher than heaven. How does that help you trust Him when you do not understand?

Memory Verse

“Can you fathom the mystery of God? Or can you probe the limits of the Almighty?

Job 11:7 (WEB)

Copy It

Prayer

Dear God, thank You for being bigger than I can understand. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you stay humble when you feel sure you are right?
  • How can you keep from being harsh when you disagree?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Job 11 · Grade 5

The Limits of the Almighty

Name Date

Read and Think

Zophar the Naamathite enters the debate with impatience. Shouldn't the multitude of words be answered? Should a man full of talk be justified? He accuses Job of claiming, My doctrine is pure. I am clean in your eyes. Zophar wishes God would speak and show Job the secrets of wisdom, and he adds a cruel claim: Know therefore that God exacts of you less than your iniquity deserves. The reader knows this is false.

Zophar's best words concern God's greatness. Can you fathom the mystery of God? Or can you probe the limits of the Almighty? They are high as heaven. What can you do? They are deeper than Sheol. What can you know? Its measure is longer than the earth, and broader than the sea. Ironically, Zophar does not apply this truth to himself. If God's ways cannot be fathomed, Zophar cannot be sure he knows why Job suffers.

Zophar ends with a call to repentance: If you set your heart aright, stretch out your hands toward him. If iniquity is in your hand, put it far away. He promises that life will be clearer than the noonday, and though there is darkness, it will be as the morning. Repentance is good counsel for sinners, but Zophar misjudges Job. In Job 42:7 God says the friends have not spoken of Him what is right, as His servant Job has.

Show What You Know

  1. What does Zophar accuse Job of claiming?

  2. What cruel claim does Zophar make?

  3. How does Zophar describe the limits of the Almighty?

  4. What is ironic about Zophar's words on God's mystery?

  5. What does Zophar promise if Job repents?

Crossword

41523

Across

  1. broader than the ____
  2. You will be secure, because there is ____

Down

  1. Can you fathom the ____ of God
  2. They are high as ____
  3. The Naamathite who spoke third

Think About It

  1. Zophar spoke of God's mystery but acted as if he knew everything. How can humility shape the way you speak about God's ways?

  2. Zophar's harsh words added to Job's pain. How can you make your words a help to someone who is hurting?

Memory Verse

“Can you fathom the mystery of God? Or can you probe the limits of the Almighty?

Job 11:7 (WEB)

Copy It

Prayer

Dear God, thank You for being bigger than I can understand. Help me . Amen.

Take It Home

For families: talk about these together.

  • What can you say to a friend in pain instead of easy promises?
  • How can we speak about God's greatness with humility?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.