The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 11

Prints on letter paper in black and white. No answers are printed on the student sheet.

Job 11 · Grade 2

Zophar's Words

Name Date

Read the Story

Zophar was Job's third friend. He spoke next. He was not kind to Job. He thought Job had done wrong.

Zophar said God is higher than the sky. He said God is broader than the sea. That is true. God is very great.

Zophar told Job to turn his heart to God. He said there would be hope. But Zophar was wrong about Job. God said the friends did not speak what was right.

Memory Verse

“Can you fathom the mystery of God? Or can you probe the limits of the Almighty?

Job 11:7 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who was Job's third friend?

    The skyZopharTurn his heart to God

  2. What did Zophar think?

  3. What did Zophar say God is higher than?

    ZopharThe skyTurn his heart to God

  4. What did Zophar tell Job to do?

  5. Was Zophar right about Job?

Word Search

Find and circle each word. Words go across and down.

HLHEAVENMHTMYSTERYYSYHSMKPPHECJOBVJCFCMGTPRAGEUDEEPERHFRDZOPHAREEKRRESTOGSEAVOREA
  • MYSTERY
  • ZOPHAR
  • HEAVEN
  • SECURE
  • DEEPER
  • HOPE
  • REST
  • SEA

Prayer

Dear God, thank You for being bigger than I can understand. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you speak kindly to someone who is hurting?
  • How can you speak to a sad friend gently?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.