The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 7

For teachers and parents. Prints separately from the student sheets.

Jeremiah 7 · For teachers and parents

Answer Key: Amend Your Ways

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolListen to God's Voice

Templehouseheartpersonsun

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod's House

HOUSE → picture 4WAY → picture 3LOVE → picture 1PEOPLE → picture 2

Grade 1Change Your Ways

Jeremiah stood in the temple gate. → picture 5God said to change their ways. → picture 1God wanted justice. → picture 4The people did not listen. → picture 2God wanted them to be his people. → picture 3

Order:

1. Stand in the gate of Yahweh’s house2. Amend your ways and your doings3. Listen to my voice, and I will be your God, and you shall be my people4. Walk in all the way that I command you, that it may be well with you

Grade 2Stand in the Gate

  1. Where did Jeremiah stand? At the gate of God's house
  2. What did Jeremiah tell the people? To change their ways (circle)
  3. What did the people think? The temple would keep them safe
  4. What did God want them to obey? His voice (circle)
  5. What would God be? Their God (circle)
BTTRUTHAFGUHELUGOBAAYJMGGVVJGDLVPBBYVLAYEPLTOWOUTGLEEMRAINEACWSYFYCRCPJSECGSEECTK

Grade 3Not Just a Building

  1. Where did God send Jeremiah? To the gate of the temple
  2. What did Jeremiah tell them to amend? Their ways and their doings
  3. What did the people think would protect them? The temple building
  4. Who did they fail to care for? The foreigner, the fatherless, and the widow
  5. What did God say mattered most? Obeying his voice
1: Stand in the gate of Yahweh’s house2: Amend your ways and your doings3: Listen to my voice, and I will be your God, and you shall be my people4: Walk in all the way that I command you, that it may be well with you
WJVPTRUTHAJDLOBOACCOPAVLYCTCHOCVOICELFSECSYEMGEHWGATEPFVGAPITCLHHEYPOEVEETVSFPIKO

Grade 4A Den of Robbers

  1. What lying words did the people trust? That the temple building would keep them safe
  2. What does a den of robbers picture? A hiding place where people feel safe after doing wrong
  3. Why did God mention Shiloh? His tabernacle had stood there, and it was later ruined
  4. What simple command had God given from the start? Listen to my voice, and I will be your God

Word bank: 1. ways; 2. God; 3. temple; 4. voice

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5The Temple Sermon

  1. What slogan did the people trust? Yahweh's temple repeated three times
  2. What concrete changes did God require? Justice for neighbors and care for the foreigner, fatherless, and widow
  3. What warning did Shiloh give? A holy place cannot shield an unholy people
  4. What was God's core command from Egypt? Listen to my voice, and I will be your God
2WAYS1PLCE3GA4TRUTH

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.