The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 7

Every grade prints starting on a new page. No answers are included.

Jeremiah 7 · Preschool

Listen to God's Voice

Name Date

Color the temple and the people listening. God loves when we listen!

Can you find these in the picture? Circle each one!

Bible Verse

Yahweh of Armies, the God of Israel says, “Amend your ways and your doings, and I will cause you to dwell in this place.

Jeremiah 7:3 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Then explain that God wanted his people to change their ways and listen to him. God loves it when we listen. Play a listening game and talk about ways to listen to God.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Jeremiah 7 · Kindergarten

God's House

Name Date

Trace the Words

Trace each word with your pencil.

HEAR
GOD
WAY
HOUSE
Yahweh of Armies, the God of Israel says, “Amend your ways and your doings, and I will cause you to dwell in this place.

Jeremiah 7:3 (WEB)

Match the Pictures

Draw a line from each word to its picture.

HOUSE
WAY
LOVE
PEOPLE

Mini Maze

Help find the way through the maze.

Draw It

Draw people coming to God's house.

Prayer

Dear God, thank You for teaching me to obey. Help me . Amen.

Take It Home

For families: talk about these together.

  • Where did Jeremiah preach?
  • What did the people trust?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Jeremiah 7 · Grade 1

Change Your Ways

Name Date

Trace the Words

Trace the words and the verse.

TEMPLE
GATE
JUSTICE
VOICE
Yahweh of Armies, the God of Israel says, “Amend your ways and your doings, and I will cause you to dwell in this place.

Jeremiah 7:3 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Jeremiah stood in the temple gate.
God said to change their ways.
God wanted justice.
The people did not listen.
God wanted them to be his people.

Amend Your Ways

Write the number 1 to 4 in each circle to show the right order.

Amend your ways and your doings

Stand in the gate of Yahweh’s house

Walk in all the way that I command you, that it may be well with you

Listen to my voice, and I will be your God, and you shall be my people

Draw people coming to God's house.

Memory Verse

Yahweh of Armies, the God of Israel says, “Amend your ways and your doings, and I will cause you to dwell in this place.

Jeremiah 7:3 (WEB)

Prayer

Dear God, thank You for teaching me to obey. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does amend your ways mean?
  • Who did God want people to protect?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Jeremiah 7 · Grade 2

Stand in the Gate

Name Date

Read the Story

God sent Jeremiah to the gate of his house. Many people came in to worship. Jeremiah told them to change their ways.

The people thought the temple would keep them safe. But they were not kind or fair. God wanted them to obey his voice. Then he would be their God.

Memory Verse

Yahweh of Armies, the God of Israel says, “Amend your ways and your doings, and I will cause you to dwell in this place.

Jeremiah 7:3 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Where did Jeremiah stand?

  2. What did Jeremiah tell the people?

    His voiceTo change their waysTheir God

  3. What did the people think?

  4. What did God want them to obey?

    Their GodAt the gate of God's houseHis voice

  5. What would God be?

    To change their waysHis voiceTheir God

Word Search

Find and circle each word. Words go across and down.

BTTRUTHAFGUHELUGOBAAYJMGGVVJGDLVPBBYVLAYEPLTOWOUTGLEEMRAINEACWSYFYCRCPJSECGSEECTK
  • TEMPLE
  • VOICE
  • TRUTH
  • PLACE
  • GATE
  • WAYS

Prayer

Dear God, thank You for teaching me to obey. Help me . Amen.

Take It Home

For families: talk about these together.

  • What is a den of robbers?
  • Why did God mention Shiloh?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Jeremiah 7 · Grade 3

Not Just a Building

Name Date

Read the Story

God sent Jeremiah to stand in the gate of the temple. People came through the gate to worship. Jeremiah gave them a message from God. He told them to amend their ways and their doings.

The people kept saying the temple of Yahweh over and over. They thought the building would protect them. But they did not treat others fairly. They did not care for the foreigner, the fatherless, and the widow.

God said obeying his voice mattered most. He had told their fathers to walk in all his ways. God sent prophets again and again. Still the people did not listen.

Memory Verse

Yahweh of Armies, the God of Israel says, “Amend your ways and your doings, and I will cause you to dwell in this place.

Jeremiah 7:3 (WEB)

Answer the Questions

  1. Where did God send Jeremiah?

  2. What did Jeremiah tell them to amend?

  3. What did the people think would protect them?

  4. Who did they fail to care for?

  5. What did God say mattered most?

Amend Your Ways

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

WJVPTRUTHAJDLOBOACCOPAVLYCTCHOCVOICELFSECSYEMGEHWGATEPFVGAPITCLHHEYPOEVEETVSFPIKO
  • TEMPLE
  • VOICE
  • TRUTH
  • PLACE
  • GATE
  • WAYS

Prayer

Dear God, thank You for teaching me to obey. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can we obey God from the heart and not just go through the motions?
  • In the New Testament, how did Jesus use Jeremiah's words?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Jeremiah 7 · Grade 4

A Den of Robbers

Name Date

Read and Think

God sent Jeremiah to stand at the gate of Yahweh's house and preach to all who entered. The people trusted in lying words. They repeated that this was Yahweh's temple, as if the building were a lucky charm. God told them to amend their ways and to execute justice between neighbors.

God asked a hard question. Had his house become a den of robbers in their eyes? Robbers hide in a den after doing wrong, and the people were doing the same. They broke God's commands all week and then came to the temple feeling safe. God reminded them of Shiloh, where his tabernacle once stood. It was later ruined.

In the New Testament, Jesus used these words when he cleared the temple (Matthew 21:13). God's command from the start had been simple. Listen to my voice, and I will be your God, and you shall be my people.

Show What You Know

  1. What lying words did the people trust?

  2. What does a den of robbers picture?

  3. Why did God mention Shiloh?

  4. What simple command had God given from the start?

Word Bank Fill-In

Use the word bank to fill in each blank.

voicetemplewaysGod
  1. God told them to amend their and to execute justice between neighbors.
  2. asked a hard question.
  3. In the New Testament, Jesus used these words when he cleared the (Matthew 21:13).
  4. Listen to my , and I will be your God, and you shall be my people.

Think About It

  1. Why might someone think going to worship makes it fine to treat others badly?

  2. How do kindness and fairness show that worship is real?

Memory Verse

Has this house, which is called by my name, become a den of robbers in your eyes? Behold, I myself have seen it,” says Yahweh.

Jeremiah 7:11 (WEB)

Copy It

Prayer

Dear God, thank You for teaching me to obey. Help me . Amen.

Take It Home

For families: talk about these together.

  • Can a building keep us safe?
  • How do we show real worship?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Jeremiah 7 · Grade 5

The Temple Sermon

Name Date

Read and Think

Jeremiah 7 records what is often called the temple sermon. God told Jeremiah to stand in the gate of Yahweh's house and call all of Judah to amend their ways and their doings. The people had a slogan. They repeated Yahweh's temple three times, believing God would never allow his house to fall. Jeremiah called this trusting in lying words that can't profit.

God's conditions were concrete. They must execute justice between a man and his neighbor, not oppress the foreigner, the fatherless, and the widow, not shed innocent blood, and not walk after other gods. Instead they stole, lied, and broke covenant, then stood before God and said they were delivered. God asked whether his house had become a den of robbers. In the New Testament, Jesus quoted this when he cleared the temple (Matthew 21:13).

God pointed to Shiloh, where the tabernacle once stood. It had been destroyed, a warning that a holy place cannot shield an unholy people. God also said that when he brought Israel out of Egypt, his core command was not about sacrifices. It was this. Listen to my voice, and I will be your God, and you shall be my people.

Show What You Know

  1. What slogan did the people trust?

  2. What concrete changes did God require?

  3. What warning did Shiloh give?

  4. What was God's core command from Egypt?

Crossword

2134

Across

  1. Amend your ____ and your doings.
  2. Stand in the ____ of Yahweh’s house.

Down

  1. And I will cause you to dwell in this ____.
  2. ____ has perished, and is cut off from their mouth.

Think About It

  1. Religious places and habits are good gifts. How can they become something people hide behind?

  2. In the New Testament, Jesus quoted Jeremiah 7 in the temple (Matthew 21:13). What does that show about how God sees worship and daily life?

Memory Verse

“Don’t trust in lying words, saying, ‘Yahweh’s temple, Yahweh’s temple, Yahweh’s temple, are these.’”

Jeremiah 7:4 (WEB)

Copy It

Prayer

Dear God, thank You for teaching me to obey. Help me . Amen.

Take It Home

For families: talk about these together.

  • What happens when we listen to God's voice?
  • Why did the people not listen?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.