The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 5

Every grade prints starting on a new page. No answers are included.

Isaiah 5 · Preschool

God's Vineyard

Name Date

Color the grapes, the vine, and the tower. God takes good care of His vineyard.

Can you find these in the picture? Circle each one!

Bible Verse

“Let me sing for my well beloved a song of my beloved about his vineyard. My beloved had a vineyard on a very fruitful hill.”

Isaiah 5:1 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God is like a farmer who takes care of His plants. He wants us to grow good fruit, like kindness and love. Let's ask God to help us grow good fruit.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 5 · Kindergarten

Good Grapes

Name Date

Trace the Words

Trace each word with your pencil.

VINE
GRAPES
HILL
TOWER
Let me sing for my well beloved a song of my beloved about his vineyard. My beloved had a vineyard on a very fruitful hill.

Isaiah 5:1 (WEB)

Match the Pictures

Draw a line from each word to its picture.

GRAPES
VINE
HILL
TOWER

Mini Maze

Help find the way through the maze.

Draw It

Draw a vineyard with a tower.

Prayer

Dear God, thank You for caring for Your vineyard. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you make God happy?
  • Who takes care of the vineyard?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 5 · Grade 1

The Vineyard Song

Name Date

Trace the Words

Trace the words and the verse.

VINEYARD
GRAPES
JUSTICE
HOLY
Let me sing for my well beloved a song of my beloved about his vineyard. My beloved had a vineyard on a very fruitful hill.

Isaiah 5:1 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

The vineyard was on a fruitful hill.
He built a tower in it.
He looked for good grapes.
It grew wild grapes.
Do not call darkness light.

God's Vineyard

Write the number 1 to 4 in each circle to show the right order.

For the vineyard of Yahweh of Armies is the house of Israel

He looked for it to yield grapes, but it yielded wild grapes.

God the Holy One is sanctified in righteousness

My beloved had a vineyard on a very fruitful hill

Draw a vineyard with a tower.

Memory Verse

“Let me sing for my well beloved a song of my beloved about his vineyard. My beloved had a vineyard on a very fruitful hill.”

Isaiah 5:1 (WEB)

Prayer

Dear God, thank You for caring for Your vineyard. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did the man build?
  • What good can you grow in your life?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 5 · Grade 2

The Vineyard

Name Date

Read the Story

Isaiah sang a song. A man had a vineyard on a hill. He took out the stones. He planted the best vines. He built a tower. He looked for good grapes. But it grew wild grapes.

The vineyard was God's people. God looked for justice. But he found people being hurt. Isaiah warned people who call evil good. He warned people who are wise in their own eyes.

Memory Verse

“Let me sing for my well beloved a song of my beloved about his vineyard. My beloved had a vineyard on a very fruitful hill.”

Isaiah 5:1 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Where was the vineyard?

    JusticeGod's peopleOn a hill

  2. What did the man build?

    On a hillA towerWild grapes

  3. What did the vineyard grow?

    Wild grapesA towerJustice

  4. Who was the vineyard?

    A towerGod's peopleJustice

  5. What did God look for?

    JusticeA towerWild grapes

Word Search

Find and circle each word. Words go across and down.

DKYHPBKGMRVBELOVEDJTIJOAWAPUGONSTEICSTRWEHILLTISAEYGENIHPEPRAMSCFNYYEORGEHOLYNSLD
  • VINEYARD
  • JUSTICE
  • BELOVED
  • GRAPES
  • TOWER
  • HILL
  • HOLY

Prayer

Dear God, thank You for caring for Your vineyard. Help me . Amen.

Take It Home

For families: talk about these together.

  • The owner did all he could for his plants. What good things has God given you to help you grow?
  • How can you be fair to others?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 5 · Grade 3

Wild Grapes

Name Date

Read the Story

Isaiah sang a song about a vineyard. The owner dug it up and gathered out its stones. He planted it with the choicest vine. He built a tower in the middle of it. He looked for it to yield grapes, but it yielded wild grapes.

The owner asked, "What could have been done more to my vineyard, that I have not done in it?" Then Isaiah explained the song. The vineyard of Yahweh is the house of Israel. God looked for justice and righteousness. But he found oppression and a cry of distress.

Isaiah gave warnings called woes. He warned those who call evil good, and good evil. He warned those who are wise in their own eyes. He warned those who take money to let the guilty go free. They had rejected the law of Yahweh.

Memory Verse

“For the vineyard of Yahweh of Armies is the house of Israel, and the men of Judah his pleasant plant. He looked for justice, but behold, oppression, for righteousness, but behold, a cry of distress.”

Isaiah 5:7 (WEB)

Answer the Questions

  1. What did the owner plant?

  2. What did the vineyard yield?

  3. Who is the vineyard of Yahweh?

  4. What did God find instead of justice?

  5. What had the people rejected?

God's Vineyard

Write what happened in each box.

1
2
3
4

Prayer

Dear God, thank You for caring for Your vineyard. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does it mean to call evil good?
  • Why is it wrong to be wise in your own eyes?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 5 · Grade 4

Woe to Those Who Call Evil Good

Name Date

Read and Think

Isaiah 5 begins as a love song. "My beloved had a vineyard on a very fruitful hill." He dug it, cleared the stones, planted the best vines, built a watchtower, and cut out a wine press. He did everything a good farmer could do. But when harvest came, there were only wild grapes.

The owner asked the people of Judah to judge between him and his vineyard. Since it gave only wild grapes, he would take away its hedge and let it become a wasteland. Then Isaiah reveals the meaning: "For the vineyard of Yahweh of Armies is the house of Israel." God looked for justice, but found oppression; for righteousness, but heard a cry of distress.

Six woes follow. Isaiah warns those who buy up house after house, those who chase strong drink, and those who mock God's plan. He warns "those who call evil good, and good evil," those who are wise in their own eyes, and those who take bribes. Because they rejected the law of Yahweh, God would lift up a banner and call a strong nation from far away against them.

Show What You Know

  1. List three things the owner did for his vineyard.

  2. What would the owner do to the vineyard?

  3. What did God find instead of righteousness?

  4. What would God lift up for a nation far away?

Word Bank Fill-In

Use the word bank to fill in each blank.

vineyardgoodgrapesGod
  1. He did everything a farmer could do.
  2. But when harvest came, there were only wild .
  3. The owner asked the people of Judah to judge between him and his .
  4. Because they rejected the law of Yahweh, would lift up a banner and call a strong nation from far away against them.

Think About It

  1. God did everything for his vineyard and looked for good fruit. What good fruit does God want to see in your life?

  2. Isaiah warns against calling evil good. Where do you see people mix up right and wrong today?

Memory Verse

“Woe to those who call evil good, and good evil; who put darkness for light, and light for darkness; who put bitter for sweet, and sweet for bitter!”

Isaiah 5:20 (WEB)

Copy It

Prayer

Dear God, thank You for caring for Your vineyard. Help me . Amen.

Take It Home

For families: talk about these together.

  • What is one good habit you want God to build in you?
  • How should we treat our neighbors' needs?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Isaiah 5 · Grade 5

Justice or Oppression?

Name Date

Read and Think

Isaiah 5 opens with a song that sounds like a love song but turns into a parable. The beloved prepared his vineyard with great care: clearing stones, planting "the choicest vine," building a tower, and cutting a wine press. The question he asks is painful: "What could have been done more to my vineyard, that I have not done in it?" Because it yielded only wild grapes, he would remove its hedge and command the clouds to rain no rain on it.

Verse 7 explains the parable. God "looked for justice, but behold, oppression, for righteousness, but behold, a cry of distress." The vineyard is the house of Israel, and the men of Judah are "his pleasant plant." In the New Testament, Jesus tells a parable about a vineyard owner and wicked tenants (Matthew 21:33-41), using the same picture of a vineyard with a hedge, a wine press, and a tower.

Six woes then describe the wild grapes. The greedy joined house to house until there was no room for anyone else. Others partied with wine and music but "don't respect the work of Yahweh." Some dared God to hurry his judgment, some reversed moral categories, putting darkness for light and bitter for sweet, and judges acquitted the guilty for a bribe. Yet Yahweh of Armies is exalted in justice. Because they rejected his law, he would whistle for a swift army from the end of the earth, and darkness would cover the land.

Show What You Know

  1. What question does the owner ask about his vineyard?

  2. Who are the vineyard and the pleasant plant?

  3. Which parable of Jesus uses the same vineyard picture?

  4. What did the greedy do?

Crossword

32415

Across

  1. My beloved had a vineyard on a very fruitful ____.
  2. Built a ____ in the middle of it.
  3. When I looked for it to yield ____.

Down

  1. But Yahweh of Armies is exalted in ____.
  2. Please judge between me and my ____.

Think About It

  1. God expected his people to show justice and righteousness. What would justice look like in your home, your town, or online?

  2. Isaiah warns those who put darkness for light. How can God's word help you tell right from wrong when others are confused?

Memory Verse

“For the vineyard of Yahweh of Armies is the house of Israel, and the men of Judah his pleasant plant. He looked for justice, but behold, oppression, for righteousness, but behold, a cry of distress.”

Isaiah 5:7 (WEB)

Copy It

Prayer

Dear God, thank You for caring for Your vineyard. Help me . Amen.

Take It Home

For families: talk about these together.

  • God hoped for goodness from His people. How can your life bring God joy?
  • Why does God care so much about justice?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.