The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 5

Prints on letter paper in black and white. No answers are printed on the student sheet.

Isaiah 5 · Grade 2

The Vineyard

Name Date

Read the Story

Isaiah sang a song. A man had a vineyard on a hill. He took out the stones. He planted the best vines. He built a tower. He looked for good grapes. But it grew wild grapes.

The vineyard was God's people. God looked for justice. But he found people being hurt. Isaiah warned people who call evil good. He warned people who are wise in their own eyes.

Memory Verse

“Let me sing for my well beloved a song of my beloved about his vineyard. My beloved had a vineyard on a very fruitful hill.”

Isaiah 5:1 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Where was the vineyard?

    JusticeGod's peopleOn a hill

  2. What did the man build?

    On a hillA towerWild grapes

  3. What did the vineyard grow?

    Wild grapesA towerJustice

  4. Who was the vineyard?

    A towerGod's peopleJustice

  5. What did God look for?

    JusticeA towerWild grapes

Word Search

Find and circle each word. Words go across and down.

DKYHPBKGMRVBELOVEDJTIJOAWAPUGONSTEICSTRWEHILLTISAEYGENIHPEPRAMSCFNYYEORGEHOLYNSLD
  • VINEYARD
  • JUSTICE
  • BELOVED
  • GRAPES
  • TOWER
  • HILL
  • HOLY

Prayer

Dear God, thank You for caring for Your vineyard. Help me . Amen.

Take It Home

For families: talk about these together.

  • The owner did all he could for his plants. What good things has God given you to help you grow?
  • How can you be fair to others?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.