The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 5

For teachers and parents. Prints separately from the student sheets.

Hosea 5 · For teachers and parents

Answer Key: Seek My Face

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolCome to God

trumpetpeoplelj and water

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod Sees

TRUMPET → picture 3FACE → picture 1HEAL → picture 4PRAY → picture 2

Grade 1Seek God's Face

God called to the priests. → picture 4God knows everything. → picture 3A trumpet warned the people. → picture 1They asked Assyria for help. → picture 5God wants them to seek Him. → picture 2

Grade 2God Knows

  1. Who did God speak to? The leaders of Israel (circle)
  2. What was hidden from God? Nothing (circle)
  3. Who did the people ask for help? Another king (circle)
  4. What was God waiting for? For them to be sorry and look for Him
VMAGSEEKLHPRIESTSTSANVPKINGFCGRHIIGIAAWHRHVKSCABGAEBBREJASIVKMAVTRUMPETEJUDAHMUNL

Grade 3Not Hidden from God

  1. Who did God call to? The priests, the people, and the king's house
  2. What was not hidden from God? Israel
  3. Who did Israel go to for help? Assyria
  4. What was God waiting for? For them to admit their wrong and seek his face
1: Judah also will stumble with them.2: Among the tribes of Israel, I have made known that which will surely be.3: I will go and return to my place, until they acknowledge their offense, and seek my face.4: In their affliction they will seek me earnestly.
TRUMPETAONIPWKIYSPCIRAEIRJPJSIWPTNALUREGHNLGSDASFRROIEAETAAEOGEHLSCISPBKMAVEMOKJK

Grade 4Israel Is Not Hidden

  1. Who did God tell to listen? The priests, the house of Israel, and the house of the king
  2. What had the leaders been? A trap instead of guides
  3. Why did the people not find God? Their hearts were not truly turned to Him.
  4. What was God waiting for? For them to acknowledge their offense and seek his face

Word bank: 1. priests; 2. Israel; 3. Ephraim; 4. seek; 5. king

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Until They Seek My Face

  1. Who did God address in this chapter? The priests, the house of Israel, and the house of the king
  2. What did their deeds keep them from doing? Turning to their God
  3. Why did their sacrifices not find God? Their hearts were not turned to Him.
  4. Why could Assyria not help? The king of Assyria is not able to heal you.
  5. What was the purpose of God's judgment? That they would acknowledge their offense and seek His face
4EARNESTLY2TRUMPE1STUMBL3FAC

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.