The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 5

Every grade prints starting on a new page. No answers are included.

Hosea 5 · Preschool

Come to God

Name Date

Color the trumpet and the hills!

Can you find these in the picture? Circle each one!

Bible Verse

I will go and return to my place, until they acknowledge their offense, and seek my face. In their affliction they will seek me earnestly.”

Hosea 5:15 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: When we do wrong, God wants us to come back to Him. Let's tell God we want to follow Him.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Hosea 5 · Kindergarten

God Sees

Name Date

Trace the Words

Trace each word with your pencil.

SEEK
GOD
FACE
HEAL
I will go and return to my place, until they acknowledge their offense, and seek my face. In their affliction they will seek me earnestly.”

Hosea 5:15 (WEB)

Match the Pictures

Draw a line from each word to its picture.

TRUMPET
FACE
HEAL
PRAY

Mini Maze

Help find the way through the maze.

Draw It

Draw someone praying to God.

Prayer

Dear God, thank You for letting me find You when I seek You. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can you look for God?
  • What did God want the people to do?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Hosea 5 · Grade 1

Seek God's Face

Name Date

Trace the Words

Trace the words and the verse.

TRUMPET
PRIESTS
PRIDE
SEEK
I will go and return to my place, until they acknowledge their offense, and seek my face. In their affliction they will seek me earnestly.”

Hosea 5:15 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

God called to the priests.
God knows everything.
A trumpet warned the people.
They asked Assyria for help.
God wants them to seek Him.

Draw someone praying to God.

Memory Verse

I will go and return to my place, until they acknowledge their offense, and seek my face. In their affliction they will seek me earnestly.”

Hosea 5:15 (WEB)

Prayer

Dear God, thank You for letting me find You when I seek You. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who helps you when you are sick?
  • How can you come to God?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Hosea 5 · Grade 2

God Knows

Name Date

Read the Story

God spoke to the leaders of Israel. He said He knew all about them. Nothing was hidden from Him. The people were proud and did not turn to God.

When they were hurt, they asked another king for help. But he could not heal them. God said He would wait until they were sorry and looked for Him.

Memory Verse

I will go and return to my place, until they acknowledge their offense, and seek my face. In their affliction they will seek me earnestly.”

Hosea 5:15 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who did God speak to?

    The leaders of IsraelAnother kingNothing

  2. What was hidden from God?

    The leaders of IsraelAnother kingNothing

  3. Who did the people ask for help?

    Another kingThe leaders of IsraelNothing

  4. What was God waiting for?

Word Search

Find and circle each word. Words go across and down.

VMAGSEEKLHPRIESTSTSANVPKINGFCGRHIIGIAAWHRHVKSCABGAEBBREJASIVKMAVTRUMPETEJUDAHMUNL
  • EPHRAIM
  • TRUMPET
  • PRIESTS
  • ISRAEL
  • JUDAH
  • SEEK
  • FACE
  • KING

Prayer

Dear God, thank You for letting me find You when I seek You. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who can you go to first when you are sick or hurt?
  • God sees everything His people do. How can you be glad that God sees you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Hosea 5 · Grade 3

Not Hidden from God

Name Date

Read the Story

God called to the priests, the people of Israel, and the king's house. He said, I know Ephraim, and Israel is not hidden from me. God knew everything they did.

The people's pride testified against them. They would go with their flocks to look for God, but they did not come with their hearts. A trumpet would sound a warning.

When Israel saw their sickness, they went to Assyria for help. But the king of Assyria could not heal them. God said He would wait until they admitted their wrong and would seek his face.

Memory Verse

I will go and return to my place, until they acknowledge their offense, and seek my face. In their affliction they will seek me earnestly.”

Hosea 5:15 (WEB)

Answer the Questions

  1. Who did God call to?

  2. What was not hidden from God?

  3. Who did Israel go to for help?

  4. What was God waiting for?

Seek God’s Face

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

TRUMPETAONIPWKIYSPCIRAEIRJPJSIWPTNALUREGHNLGSDASFRROIEAETAAEOGEHLSCISPBKMAVEMOKJK
  • EPHRAIM
  • TRUMPET
  • PRIESTS
  • ISRAEL
  • JUDAH
  • SEEK
  • FACE
  • KING

Prayer

Dear God, thank You for letting me find You when I seek You. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why could Assyria not help?
  • What sound warned the people?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Hosea 5 · Grade 4

Israel Is Not Hidden

Name Date

Read and Think

Hosea 5 opens with a call to listen. Listen to this, you priests! Listen, house of Israel, and give ear, house of the king! God said, I know Ephraim, and Israel is not hidden from me. The leaders had been a trap for the people instead of guides.

Their deeds won't allow them to turn to their God, for the spirit of prostitution is within them. Hosea uses this phrase for their love of false gods. They would come with their flocks to seek Yahweh, but they would not find Him, because their hearts were not truly turned to Him.

When Ephraim saw his sickness, he went to Assyria. But the king of Assyria is not able to heal you. God said He was like a moth and like a lion to them. Then He said, I will go and return to my place, until they acknowledge their offense, and seek my face.

Show What You Know

  1. Who did God tell to listen?

  2. What had the leaders been?

  3. Why did the people not find God?

  4. What was God waiting for?

Word Bank Fill-In

Use the word bank to fill in each blank.

priestsseekIsraelEphraimking
  1. Listen to this, you !
  2. Listen, house of , and give ear, house of the king!
  3. God said, I know , and Israel is not hidden from me.
  4. They would come with their flocks to Yahweh, but they would not find Him, because their hearts were not truly turned to Him.
  5. But the of Assyria is not able to heal you.

Think About It

  1. Israel went to Assyria for help instead of to God. Where do people look for help today instead of God?

  2. God waits for His people to seek His face. What does it mean to seek God's face?

Memory Verse

I will go and return to my place, until they acknowledge their offense, and seek my face. In their affliction they will seek me earnestly.”

Hosea 5:15 (WEB)

Copy It

Prayer

Dear God, thank You for letting me find You when I seek You. Help me . Amen.

Take It Home

For families: talk about these together.

  • Those in charge had become like a snare. When you lead others, how can you help them instead of hurt them?
  • How can you look for God when you have messed up?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Hosea 5 · Grade 5

Until They Seek My Face

Name Date

Read and Think

Hosea 5 addresses all of Israel's leadership. Listen to this, you priests! Listen, house of Israel, and give ear, house of the king! For the judgment is against you. God's knowledge is complete: I know Ephraim, and Israel is not hidden from me. The leaders had been like a snare, trapping people in sin.

Hosea shows how sin traps people. Their deeds won't allow them to turn to their God, for the spirit of prostitution is within them, and they don't know Yahweh. They brought sacrifices, but they won't find him. He has withdrawn himself from them. Religious activity without a turned heart does not reach God.

When Ephraim saw his sickness, and Judah his wound, Ephraim went to Assyria. But the king of Assyria is not able to heal you. God describes Himself as a moth to Ephraim and a lion to Judah. The judgment had a purpose: I will go and return to my place, until they acknowledge their offense, and seek my face. In their affliction they will seek me earnestly.

Show What You Know

  1. Who did God address in this chapter?

  2. What did their deeds keep them from doing?

  3. Why did their sacrifices not find God?

  4. Why could Assyria not help?

  5. What was the purpose of God's judgment?

Crossword

4213

Across

  1. they will seek me ____

Down

  1. Judah also will ____ with them.
  2. and the ____ in Ramah
  3. and seek my ____

Think About It

  1. In their affliction they will seek me earnestly. How can hard times draw people closer to God?

  2. Religious activity without a turned heart does not reach God. How can you make sure your heart is in your worship?

Memory Verse

I will go and return to my place, until they acknowledge their offense, and seek my face. In their affliction they will seek me earnestly.”

Hosea 5:15 (WEB)

Copy It

Prayer

Dear God, thank You for letting me find You when I seek You. Help me . Amen.

Take It Home

For families: talk about these together.

  • How have you seen God's correction show His love for you?
  • When things go wrong, how can you run to God for help?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.