The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 5

Prints on letter paper in black and white. No answers are printed on the student sheet.

Hosea 5 · Grade 2

God Knows

Name Date

Read the Story

God spoke to the leaders of Israel. He said He knew all about them. Nothing was hidden from Him. The people were proud and did not turn to God.

When they were hurt, they asked another king for help. But he could not heal them. God said He would wait until they were sorry and looked for Him.

Memory Verse

I will go and return to my place, until they acknowledge their offense, and seek my face. In their affliction they will seek me earnestly.”

Hosea 5:15 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Who did God speak to?

    The leaders of IsraelAnother kingNothing

  2. What was hidden from God?

    The leaders of IsraelAnother kingNothing

  3. Who did the people ask for help?

    Another kingThe leaders of IsraelNothing

  4. What was God waiting for?

Word Search

Find and circle each word. Words go across and down.

VMAGSEEKLHPRIESTSTSANVPKINGFCGRHIIGIAAWHRHVKSCABGAEBBREJASIVKMAVTRUMPETEJUDAHMUNL
  • EPHRAIM
  • TRUMPET
  • PRIESTS
  • ISRAEL
  • JUDAH
  • SEEK
  • FACE
  • KING

Prayer

Dear God, thank You for letting me find You when I seek You. Help me . Amen.

Take It Home

For families: talk about these together.

  • Who can you go to first when you are sick or hurt?
  • God sees everything His people do. How can you be glad that God sees you?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.