The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 2

For teachers and parents. Prints separately from the student sheets.

Hosea 2 · For teachers and parents

Answer Key: A Door of Hope

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolGod Loves Forever

heartdoorplantspeople

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenForever Love

LOVE → picture 4DOOR → picture 3GRAPES → picture 2GRAIN → picture 1

Grade 1A Door of Hope

God gave grain. → picture 3His people chased false gods. → picture 5God opened a door of hope. → picture 2God spoke kindly. → picture 4God promised to love forever. → picture 1

Order:

1. Therefore behold, I will allure her, and bring her into the wilderness, and speak tenderly to her.2. I will break the bow, the sword, and the battle out of the land, and will make them lie down safely.3. I will betroth you to me forever.4. I will even betroth you to me in faithfulness; and you shall know Yahweh.

Grade 2God Speaks Kindly

  1. What did God give His people? Grain, oil, and wine (circle)
  2. Who did they thank instead? False gods (circle)
  3. How would God speak to them? Tenderly (circle)
  4. How long will God love His people? Forever (circle)
MWPHOPEVPBLIGELOELNEGNRRNIKMMTLEAARLARERHFIITYWIRODTNOKWDECTOIJCMKATYHOLPJUSTICER

Grade 3I Will Betroth You Forever

  1. Who did the people thank instead of God? The Baals
  2. Why would God take back His gifts? So they would see that they needed Him
  3. What would the valley of Achor become? A door of hope
  4. What four things describe God's promise? Righteousness, justice, loving kindness, and compassion
1: Therefore behold, I will allure her, and bring her into the wilderness, and speak tenderly to her.2: I will break the bow, the sword, and the battle out of the land, and will make them lie down safely.3: I will betroth you to me forever.4: I will even betroth you to me in faithfulness; and you shall know Yahweh.
LTBRVCWISFBETROTHHPTHHHOIMJMVOSLOELWACGMEWPNMSJUSTICEEVVYCHNKTRDOORTEOLCBRGRAINYY

Grade 4Speak Tenderly

  1. What did Israel not know? That God gave her the grain, the new wine, and the oil
  2. Why would God take back His gifts? To bring her back to Him
  3. What would God give for a door of hope? The valley of Achor
  4. What would God say to those who were not His people? You are my people.

Word bank: 1. grain; 2. hope; 3. betroth; 4. God

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5A Door of Hope

  1. Who did Israel credit for her bread and oil? The Baals
  2. What was God's goal in taking back His gifts? To bring her back to Him
  3. What does the valley of Achor become? A door of hope
  4. How long will God betroth His people? Forever
  5. In the New Testament, what does Paul say they will be called? Children of the living God
4DOOR1FOREVE2KNW3SAFLY

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.