The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 2

Every grade prints starting on a new page. No answers are included.

Hosea 2 · Preschool

God Loves Forever

Name Date

Color the vineyard and the door of hope!

Can you find these in the picture? Circle each one!

Bible Verse

“I will betroth you to me forever. Yes, I will betroth you to me in righteousness, in justice, in loving kindness, and in compassion.”

Hosea 2:19 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: God promises to love His people forever. Let's thank God for His kind and faithful love.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Hosea 2 · Kindergarten

Forever Love

Name Date

Trace the Words

Trace each word with your pencil.

LOVE
HOPE
DOOR
VINE
I will even betroth you to me in faithfulness; and you shall know Yahweh.

Hosea 2:20 (WEB)

Match the Pictures

Draw a line from each word to its picture.

LOVE
DOOR
GRAPES
GRAIN

Mini Maze

Help find the way through the maze.

Draw It

Draw a door of hope.

Prayer

Dear God, thank You for Your faithful love. Help me . Amen.

Take It Home

For families: talk about these together.

  • What did God give His people?
  • How long will God love His people?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Hosea 2 · Grade 1

A Door of Hope

Name Date

Trace the Words

Trace the words and the verse.

GRAIN
WINE
HOPE
LOVE
I will even betroth you to me in faithfulness; and you shall know Yahweh.

Hosea 2:20 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

God gave grain.
His people chased false gods.
God opened a door of hope.
God spoke kindly.
God promised to love forever.

A Door of Hope

Write the number 1 to 4 in each circle to show the right order.

Therefore behold, I will allure her, and bring her into the wilderness, and speak tenderly to her.

I will break the bow, the sword, and the battle out of the land, and will make them lie down safely.

I will even betroth you to me in faithfulness; and you shall know Yahweh.

I will betroth you to me forever.

Draw a door of hope.

Memory Verse

“I will even betroth you to me in faithfulness; and you shall know Yahweh.”

Hosea 2:20 (WEB)

Prayer

Dear God, thank You for Your faithful love. Help me . Amen.

Take It Home

For families: talk about these together.

  • How does God show you He still loves you?
  • How can you thank God for His gifts?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Hosea 2 · Grade 2

God Speaks Kindly

Name Date

Read the Story

God gave His people grain and oil and wine. But they forgot Him. They thanked false gods instead.

God still loved His people. He said He would bring them to a quiet place and speak tenderly to them. He would give them a door of hope. God promised to love them forever, with kindness and mercy.

Memory Verse

“I will betroth you to me forever. Yes, I will betroth you to me in righteousness, in justice, in loving kindness, and in compassion.”

Hosea 2:19 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did God give His people?

    ForeverGrain, oil, and wineFalse gods

  2. Who did they thank instead?

    False godsForeverTenderly

  3. How would God speak to them?

    False godsGrain, oil, and wineTenderly

  4. How long will God love His people?

    False godsForeverGrain, oil, and wine

Word Search

Find and circle each word. Words go across and down.

MWPHOPEVPBLIGELOELNEGNRRNIKMMTLEAARLARERHFIITYWIRODTNOKWDECTOIJCMKATYHOLPJUSTICER
  • BETROTH
  • JUSTICE
  • MERCY
  • GRAIN
  • HOPE
  • DOOR
  • WINE
  • OIL

Prayer

Dear God, thank You for Your faithful love. Help me . Amen.

Take It Home

For families: talk about these together.

  • God said He would lead His people to a quiet place. When do you feel God's kindness?
  • Every good gift comes from God. What good food can you thank God for at your table?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Hosea 2 · Grade 3

I Will Betroth You Forever

Name Date

Read the Story

God's people forgot that He gave her the grain, the new wine, and the oil. They gave thanks to the Baals, false gods. God said He would take back His gifts so they would see that they needed Him.

But God did not give up. He said, I will allure her, and bring her into the wilderness, and speak tenderly to her. He would turn the valley of Achor, a place of trouble, into a door of hope.

God said His people would call Him my husband. He would make them safe. He promised to betroth them to Him forever, in righteousness, in justice, in loving kindness, and in compassion. Then they would know Yahweh.

Memory Verse

“I will betroth you to me forever. Yes, I will betroth you to me in righteousness, in justice, in loving kindness, and in compassion.”

Hosea 2:19 (WEB)

Answer the Questions

  1. Who did the people thank instead of God?

  2. Why would God take back His gifts?

  3. What would the valley of Achor become?

  4. What four things describe God's promise?

A Door of Hope

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

LTBRVCWISFBETROTHHPTHHHOIMJMVOSLOELWACGMEWPNMSJUSTICEEVVYCHNKTRDOORTEOLCBRGRAINYY
  • BETROTH
  • JUSTICE
  • MERCY
  • GRAIN
  • HOPE
  • DOOR
  • WINE
  • OIL

Prayer

Dear God, thank You for Your faithful love. Help me . Amen.

Take It Home

For families: talk about these together.

  • The people chased other gods and forgot who fed them. How can you remember that every good thing comes from God?
  • What would they call God?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Hosea 2 · Grade 4

Speak Tenderly

Name Date

Read and Think

Hosea 2 continues the picture of Israel as God's wife who has been unfaithful. She went after the Baals, saying they gave her bread and wool. But she didn't know that God gave her the grain, the new wine, and the oil, and the silver and gold that they used for Baal.

So God said He would take back His grain in its time, and stop her feasts. This was not because He stopped loving her. It was to bring her back. Then she will say she will return to her first husband, for then it was better with her than now.

God's answer is full of love. He said, I will allure her, and bring her into the wilderness, and speak tenderly to her. He would give the valley of Achor for a door of hope. He will betroth her to Him in righteousness, in justice, in loving kindness, and in compassion. God would say to those who were not His people, you are my people.

Show What You Know

  1. What did Israel not know?

  2. Why would God take back His gifts?

  3. What would God give for a door of hope?

  4. What would God say to those who were not His people?

Word Bank Fill-In

Use the word bank to fill in each blank.

betrothGodgrainhope
  1. So God said He would take back His in its time, and stop her feasts.
  2. He would give the valley of Achor for a door of .
  3. He will her to Him in righteousness, in justice, in loving kindness, and in compassion.
  4. would say to those who were not His people, you are my people.

Think About It

  1. Israel thanked false gods for gifts that came from God. What gifts from God can you thank Him for today?

  2. God turned a valley of trouble into a door of hope. How can God bring hope out of hard times?

Memory Verse

“I will give her vineyards from there, and the valley of Achor for a door of hope; and she will respond there as in the days of her youth, and as in the day when she came up out of the land of Egypt.”

Hosea 2:15 (WEB)

Copy It

Prayer

Dear God, thank You for Your faithful love. Help me . Amen.

Take It Home

For families: talk about these together.

  • What four words describe God's promise?
  • God promised peace between His people, the animals, and the land. How can you care for God's creation?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Hosea 2 · Grade 5

A Door of Hope

Name Date

Read and Think

Hosea 2 is a courtroom speech and a love song at once. Israel is pictured as a wife who left her husband to chase after the Baals, the gods of rain and harvest. She credited them for her bread, wool, and oil. But she didn't know that God gave her the grain, the new wine, and the oil, and multiplied to her silver and gold, which they used for Baal.

Because of this, God would take back His gifts and cause all her celebrations to cease. His goal was not to destroy her but to bring her to the end of herself, until she would say she would return to her first husband. God sometimes removes what we trust so that we turn back to Him.

Then the tone changes. I will allure her, and bring her into the wilderness, and speak tenderly to her. The valley of Achor, once a place of trouble, becomes a door of hope. God says His people will call Him my husband. I will betroth you to me forever. Yes, I will betroth you to me in righteousness, in justice, in loving kindness, and in compassion. In the New Testament, Paul applies these words to God's people: It will be that in the place where it was said to them, You are not my people, there they will be called children of the living God (Romans 9:26).

Show What You Know

  1. Who did Israel credit for her bread and oil?

  2. What was God's goal in taking back His gifts?

  3. What does the valley of Achor become?

  4. How long will God betroth His people?

  5. In the New Testament, what does Paul say they will be called?

Crossword

4123

Across

  1. and you shall ____ Yahweh
  2. will make them lie down ____
  3. the valley of Achor for a ____ of hope

Down

  1. I will betroth you to me ____.

Think About It

  1. God speaks tenderly to people who wandered from Him. How should that change the way you come to God after you sin?

  2. God's love is in righteousness, justice, loving kindness, and compassion. Which of these do you most need to remember this week?

Memory Verse

“I will betroth you to me forever. Yes, I will betroth you to me in righteousness, in justice, in loving kindness, and in compassion.”

Hosea 2:19 (WEB)

Copy It

Prayer

Dear God, thank You for Your faithful love. Help me . Amen.

Take It Home

For families: talk about these together.

  • God promised a day when Israel would call Him my husband and not my master. What changes when we see God as loving and not only as a boss?
  • Israel decorated herself to chase false gods and forgot God. What can pull your heart away from God without you noticing?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.