The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 10

Prints on letter paper in black and white. No answers are printed on the student sheet.

Hebrews 10 · Grade 2

Meet Together

Name Date

Read the Story

Long ago priests gave gifts to God again and again. Those gifts could not take away sins. Jesus came to do God’s will. He gave himself one time for all.

Now God’s people can come near to God. They can hold on to hope. They can help each other love and do good. They should keep meeting together. God tells them to keep going and not give up.

Memory Verse

“For you need endurance so that, having done the will of God, you may receive the promise.”

Hebrews 10:36 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. Could the old gifts take away sins?

    NoOne time for allMeeting together

  2. What did Jesus come to do?

    One time for allGod’s willCome near to God

  3. How many times did Jesus give himself?

    Meeting togetherGod’s willOne time for all

  4. What can God’s people do now?

    Come near to GodMeeting togetherNo

  5. What should they keep doing?

    NoCome near to GodMeeting together

Word Search

Find and circle each word. Words go across and down.

CBLOVEBPISOUTVHOUJHLWOYELIPODRAGLDKFPEETWPNYAEFWPCEEGIFPAVHMSSTKCROFYSMHBWDOLMEET
  • BOLDNESS
  • REWARD
  • FAITH
  • BOLD
  • HOPE
  • LOVE
  • MEET
  • HELP

Prayer

Dear God, thank You for today's Bible story. Help me to . Amen.

Take It Home

For families: talk about these together.

  • How can you thank Jesus for what he did?
  • How can friends help each other do good?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.