The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 10

For teachers and parents. Prints separately from the student sheets.

Hebrews 10 · For teachers and parents

Answer Key: Hold Fast and Draw Near

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolBe Brave

HeartpeopleHandCrown

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenDo Not Give Up

LOVE → picture 4MEET → picture 3HELP → picture 2REWARD → picture 1

Grade 1Keep Going

The law was a shadow of good things. → picture 3Jesus offered one sacrifice for sins. → picture 5We can draw near to God. → picture 2Don’t stop meeting together. → picture 4Boldness has a great reward. → picture 1

Grade 2Meet Together

  1. Could the old gifts take away sins? No (circle)
  2. What did Jesus come to do? God’s will (circle)
  3. How many times did Jesus give himself? One time for all (circle)
  4. What can God’s people do now? Come near to God (circle)
  5. What should they keep doing? Meeting together (circle)
CBLOVEBPISOUTVHOUJHLWOYELIPODRAGLDKFPEETWPNYAEFWPCEEGIFPAVHMSSTKCROFYSMHBWDOLMEET

Grade 3Draw Near

  1. What did the law have? A shadow of the good things to come
  2. What did Jesus come to do? God’s will
  3. Where did Jesus sit down? At the right hand of God
  4. Why can believers hold fast their hope? He who promised is faithful
  5. What do believers need to receive the promise? Endurance
1: Behold, I have come to do your will.2: I will remember their sins and their iniquities no more.3: In a very little while, he who comes will come and will not wait.

Grade 4One Offering Forever

  1. What is in the yearly sacrifices? A yearly reminder of sins
  2. Which psalm does the writer quote? Psalm 40
  3. Why do the priests stand day by day? They offer the same sacrifices again and again
  4. What did Christ do after his one sacrifice? He sat down at the right hand of God
  5. What should believers not forsake? Meeting together

Word bank: 1. image; 2. God; 3. boldness; 4. hope

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5You Need Endurance

  1. Whose words does Hebrews apply to Christ? The speaker in Psalm 40
  2. By what way can believers enter the holy place? A new and living way
  3. How did the readers respond when their possessions were taken? They joyfully accepted it
  4. Why do the readers need endurance? So that, having done the will of God, they may receive the promise

Word bank: 1. good; 2. hope; 3. love; 4. God

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.