The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Student sheets‹ Back to chapter 37

For teachers and parents. Prints separately from the student sheets.

Ezekiel 37 · For teachers and parents

Answer Key: The Valley of Dry Bones

Answers here are a guide. Welcome any answer that shows a child is thinking about the story, and celebrate their effort. Talk About It questions are open, so they have no set answers.

PreschoolBones Come Alive!

peoplesunplantstree

Coloring and finding page: any careful coloring is a win. Help your child point to and name each picture above.

KindergartenGod Gives Breath

BONES → picture 3BREATH → picture 1LIVE → picture 4STAND → picture 2

Grade 1Dry Bones Live

Ezekiel saw a valley of bones. → picture 4The bones came together. → picture 3God gave them breath. → picture 1They stood up like a big army. → picture 5Two sticks became one stick. → picture 2

Order:

1. Then the bones came together, bone to its bone2. I will put my Spirit in you, and you will live3. I will be their God, and they will be my people4. The nations will know that I am Yahweh who sanctifies Israel, when my sanctuary is among them forever more

Grade 2Can These Bones Live?

  1. What did Ezekiel see? A valley of dry bones
  2. What did God ask? Can these bones live? (circle)
  3. What did the bones do? Came together (circle)
  4. What did God give them? Breath (circle)
  5. What can God bring? Life and hope (circle)
NNILANDSKLAFAAKLLILCOPCVCMNIVREDFONGVGEOBONESEAVPBVHUGKVELSTICKSDREVPPLCTBGBREATH

Grade 3Breath Came Into Them

  1. Where did the Spirit take Ezekiel? To a valley full of dry bones
  2. What sound did Ezekiel hear? A rattling
  3. What happened when breath came in? They stood up, a great army
  4. Who were the bones? God's people, who felt their hope was gone
1: Then the bones came together, bone to its bone2: I will put my Spirit in you, and you will live3: I will be their God, and they will be my people4: The nations will know that I am Yahweh who sanctifies Israel, when my sanctuary is among them forever more
BONESWIPMLRMBKLWVLIFSPRCACTVLOSEERNIEKLRTOASDNKFMEIPTFLIYNLVCLHLNRDHHEKERGFKUBBRB

Grade 4You Will Live

  1. Where did the Spirit set Ezekiel down? In a valley full of dry bones
  2. What happened after Ezekiel prophesied to the breath? Breath entered the bodies, and they stood up
  3. What did the people say about their hope? That it was lost
  4. What did the two sticks show? Judah and Israel would become one nation

Word bank: 1. bones; 2. live; 3. God; 4. breath; 5. people

Think About It: answers will vary. Look for answers that connect to the passage.

Grade 5Breath, Life, and One Nation

  1. What does Ezekiel's answer Lord Yahweh, you know show? Humble faith in God's power
  2. What three meanings does the Hebrew word ruach carry? Breath, wind, and Spirit
  3. What earlier Bible scene does the two-stage revival recall? God forming Adam and then breathing life into him
  4. Which New Testament verse speaks of the Spirit giving life to mortal bodies? Romans 8:11
3STICK2LVE1BONE4POPLEREATH

Think About It: answers will vary. Look for answers that connect to the passage.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.