The Daily RootedHome StoriesGradesChurchesWhat's NewAbout
Bible:
Answer key (separate)‹ Back to chapter 37

Every grade prints starting on a new page. No answers are included.

Ezekiel 37 · Preschool

Bones Come Alive!

Name Date

Color the people standing up. God gives life!

Can you find these in the picture? Circle each one!

Bible Verse

The Lord Yahweh says to these bones: “Behold, I will cause breath to enter into you, and you will live.

Ezekiel 37:5 (WEB)

Prayer

Thank You, God, for making me!

Take It Home

Read the verse aloud. Say: Ezekiel saw a vision of dry bones. God said He would give them breath, and they would live! And they did! God gives life and hope. Let's take a deep breath and thank God for life.

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ezekiel 37 · Kindergarten

God Gives Breath

Name Date

Trace the Words

Trace each word with your pencil.

BONES
BREATH
LIVE
STAND
My tent also will be with them. I will be their God, and they will be my people.

Ezekiel 37:27 (WEB)

Match the Pictures

Draw a line from each word to its picture.

BONES
BREATH
LIVE
STAND

Mini Maze

Help find the way through the maze.

Draw It

Draw dry bones becoming people.

Prayer

Dear God, thank You for giving new life. Help me . Amen.

Take It Home

For families: talk about these together.

  • What would you like God to make new?
  • Can God give life?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ezekiel 37 · Grade 1

Dry Bones Live

Name Date

Trace the Words

Trace the words and the verse.

VALLEY
BONES
BREATH
ARMY
STICKS
My tent also will be with them. I will be their God, and they will be my people.

Ezekiel 37:27 (WEB)

Match the Pictures

Draw a line from each sentence to its picture.

Ezekiel saw a valley of bones.
The bones came together.
God gave them breath.
They stood up like a big army.
Two sticks became one stick.

The Valley of Dry Bones

Write the number 1 to 4 in each circle to show the right order.

I will put my Spirit in you, and you will live

The nations will know that I am Yahweh who sanctifies Israel, when my sanctuary is among them forever more

I will be their God, and they will be my people

Then the bones came together, bone to its bone

Draw dry bones becoming people.

Memory Verse

“My tent also will be with them. I will be their God, and they will be my people.”

Ezekiel 37:27 (WEB)

Prayer

Dear God, thank You for giving new life. Help me . Amen.

Take It Home

For families: talk about these together.

  • How can God make you strong?
  • What can you thank God for when you wake up?
  • What would you like to say to God about this chapter?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ezekiel 37 · Grade 2

Can These Bones Live?

Name Date

Read the Story

Ezekiel says he saw a valley full of dry bones. God asked, can these bones live? Ezekiel said that only God knew.

Ezekiel spoke God's words. The bones came together. God gave them breath. They stood up and lived! God can bring life and hope to His people.

Memory Verse

The Lord Yahweh says to these bones: “Behold, I will cause breath to enter into you, and you will live.

Ezekiel 37:5 (WEB)

Show What You Know

Circle the right answer, or write it on the lines.

  1. What did Ezekiel see?

  2. What did God ask?

    Can these bones live?BreathA valley of dry bones

  3. What did the bones do?

    Came togetherLife and hopeBreath

  4. What did God give them?

    A valley of dry bonesBreathCame together

  5. What can God bring?

    Life and hopeCan these bones live?Came together

Word Search

Find and circle each word. Words go across and down.

NNILANDSKLAFAAKLLILCOPCVCMNIVREDFONGVGEOBONESEAVPBVHUGKVELSTICKSDREVPPLCTBGBREATH
  • FOREVER
  • BREATH
  • PEOPLE
  • BONES
  • STICK
  • LIVE
  • LAND
  • KING

Prayer

Dear God, thank You for giving new life. Help me . Amen.

Take It Home

For families: talk about these together.

  • God did something only He could do. What hard thing can you trust God with?
  • Ezekiel did just what God told him to say. How can you obey God right away?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ezekiel 37 · Grade 3

Breath Came Into Them

Name Date

Read the Story

Ezekiel says the Spirit took him to a valley full of very dry bones. God asked if the bones could live. Ezekiel said that only God knew.

God told Ezekiel to speak to the bones. There was a rattling, and the bones came together. Then God told Ezekiel to speak to the breath. Breath came in, and they stood up, a great army.

God said the bones were his people, who felt their hope was gone. God would put his Spirit in them and bring them home. He would make them one nation again.

Memory Verse

“So I prophesied as he commanded me, and the breath came into them, and they lived, and stood up on their feet, an exceedingly great army.”

Ezekiel 37:10 (WEB)

Answer the Questions

  1. Where did the Spirit take Ezekiel?

  2. What sound did Ezekiel hear?

  3. What happened when breath came in?

  4. Who were the bones?

The Valley of Dry Bones

Write what happened in each box.

1
2
3
4

Word Search

Find each word. Words go across, down, and diagonally.

BONESWIPMLRMBKLWVLIFSPRCACTVLOSEERNIEKLRTOASDNKFMEIPTFLIYNLVCLHLNRDHHEKERGFKUBBRB
  • FOREVER
  • BREATH
  • PEOPLE
  • BONES
  • STICK
  • LIVE
  • LAND
  • KING

Prayer

Dear God, thank You for giving new life. Help me . Amen.

Take It Home

For families: talk about these together.

  • Why did the people feel hopeless?
  • What did the two sticks show?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ezekiel 37 · Grade 4

You Will Live

Name Date

Read and Think

Ezekiel says the hand of Yahweh was on him, and the Spirit set him down in a valley full of bones. They were very many and very dry. God asked, Son of man, can these bones live? Ezekiel answered that only the Lord knew.

God told Ezekiel to prophesy to the bones. As he spoke, there was a rattling, and the bones came together. Sinews, flesh, and skin covered them, but there was no breath. Then God told him to prophesy to the breath. Breath entered them, and they lived and stood up, a great army.

God explained that the bones were the house of Israel. The people said their bones were dried up and their hope was lost. God would open their graves of exile, put his Spirit in them, and settle them in their land. Then he had Ezekiel join two sticks into one, showing that Judah and Israel would be one nation under one king forever.

Show What You Know

  1. Where did the Spirit set Ezekiel down?

  2. What happened after Ezekiel prophesied to the breath?

  3. What did the people say about their hope?

  4. What did the two sticks show?

Word Bank Fill-In

Use the word bank to fill in each blank.

Godboneslivepeoplebreath
  1. Ezekiel says the hand of Yahweh was on him, and the Spirit set him down in a valley full of .
  2. God asked, Son of man, can these bones ?
  3. told Ezekiel to prophesy to the bones.
  4. Sinews, flesh, and skin covered them, but there was no .
  5. The said their bones were dried up and their hope was lost.

Think About It

  1. The people felt their hope was dried up. How can God bring hope when things seem impossible?

  2. Ezekiel answered God's question by trusting God. How does saying Lord, you know show faith?

Memory Verse

I will put my Spirit in you, and you will live. Then I will place you in your own land; and you will know that I, Yahweh, have spoken it and performed it,” says Yahweh.’”

Ezekiel 37:14 (WEB)

Copy It

Prayer

Dear God, thank You for giving new life. Help me . Amen.

Take It Home

For families: talk about these together.

  • What does ruach mean?
  • When you feel hopeless, how can you remember God gives new life?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.

Ezekiel 37 · Grade 5

Breath, Life, and One Nation

Name Date

Read and Think

Ezekiel 37 is the most famous vision in the book. Ezekiel says the hand of Yahweh was on him, and he was set down in a valley full of bones, very many and very dry. They pictured an army long dead. God's question, Son of man, can these bones live? had no human answer. Ezekiel's reply, that only the Lord knew, expresses humble faith.

The bones came to life in two stages. First, at Ezekiel's word they rattled together and were covered with sinews, flesh, and skin, but there was no breath in them. Second, Ezekiel prophesied to the breath, and it entered them. The Hebrew word ruach means breath, wind, and Spirit, and the chapter plays on all three. Like Adam in Genesis 2, the bodies were formed first, then given the breath of life.

God interpreted the vision: the bones are the whole house of Israel. They said, Our bones are dried up, and our hope is lost. God promised to bring them out of their graves of exile, put his Spirit in them, and bring them home. The sign of the two sticks promised that the divided kingdoms would become one under one shepherd, David. God's tent would be with them. In the New Testament, Romans 8:11 says that the Spirit of him who raised Jesus from the dead will also give life to your mortal bodies.

Show What You Know

  1. What does Ezekiel's answer Lord Yahweh, you know show?

  2. What three meanings does the Hebrew word ruach carry?

  3. What earlier Bible scene does the two-stage revival recall?

  4. Which New Testament verse speaks of the Spirit giving life to mortal bodies?

Crossword

3214

Across

  1. But there was no ____ in them
  2. I will take the ____ of Joseph
  3. So they will be my ____

Down

  1. The Lord Yahweh says to these ____
  2. Can these bones ____

Think About It

  1. The exiles said their hope was lost. When have you felt hopeless, and how does this vision speak to that feeling?

  2. God's breath brought the bodies to life. What does it mean that God's Spirit gives spiritual life today?

Memory Verse

I will put my Spirit in you, and you will live. Then I will place you in your own land; and you will know that I, Yahweh, have spoken it and performed it,” says Yahweh.’”

Ezekiel 37:14 (WEB)

Copy It

Prayer

Dear God, thank You for giving new life. Help me . Amen.

Take It Home

For families: talk about these together.

  • Where in your church or family could God bring people back together?
  • How does Romans 8:11 connect to Ezekiel 37?
  • What is one way you could live out this chapter this week?

Scripture: World English Bible, public domain, eBible.org. © 2026 The Daily Rooted. Free to print and copy for church and home use; not for resale. Original line art.